HspA6 Recombinant Protein Antigen

Images

 
There are currently no images for HspA6 Protein (NBP1-85949PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HspA6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPA6.

Source: E. coli

Amino Acid Sequence: EVERMVHEAEQYKAEDEAQRDRVAAKNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRELEQICRPIFSRLYG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPA6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85949.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HspA6 Recombinant Protein Antigen

  • heat shock 70 kDa protein 6
  • Heat shock 70 kDa protein B'
  • heat shock 70kD protein 6 (HSP70B')
  • heat shock 70kDa protein 6 (HSP70B')
  • HSP70B'

Background

HSP70B is a unique member of the human Hsp70 chaperone involved in cellular processes such as protein trafficking, folding, and prevention of aggregation. This protein is strictly stress-inducible, having little or no basal expression levels in most cells. HSP70B and Hsp72 are closely related and play cooperative roles in cell survival of proteotoxic stress. Recombinant human HSP70B, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DYC1663-2
Species: Hu, Mu, Rt
Applications: ELISA
H00003304-M02
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP1-92012
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF2818
Species: Hu
Applications: ICC, WB
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86185
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-47708
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-88019
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-97475
Species: Ma, Hu, Mu, Pm, Rb, Rt
Applications: ELISA, GS, IP, WB
NBP1-85949PEP
Species: Hu
Applications: AC

Publications for HspA6 Protein (NBP1-85949PEP) (0)

There are no publications for HspA6 Protein (NBP1-85949PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HspA6 Protein (NBP1-85949PEP) (0)

There are no reviews for HspA6 Protein (NBP1-85949PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HspA6 Protein (NBP1-85949PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HspA6 Products

Blogs on HspA6

There are no specific blogs for HspA6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HspA6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA6