HspA4 Antibody

Images

 
Western Blot: HspA4 Antibody [H00003308-B02P] - Analysis of HSPA4 expression in human liver.
Western Blot: HspA4 Antibody [H00003308-B02P] - Analysis of HSPA4 expression in HeLa.
Western Blot: HspA4 Antibody [H00003308-B02P] - Analysis of HSPA4 expression in transfected 293T cell line by HSPA4 polyclonal antibody. Lane 1: HSPA4 transfected lysate(92.4 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HspA4 Antibody Summary

Immunogen
HSPA4 (AAI10862.1, 1 a.a. - 840 a.a.) full-length human protein. MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAMLLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALAYGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVLVNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGTMNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGKELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVFSKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKVKVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPAENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIENEGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLYEDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
Specificity
HSPA4 - heat shock 70kDa protein 4,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HSPA4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HspA4 Antibody

  • APG2
  • APG-2
  • heat shock 70 kDa protein 4
  • heat shock 70kD protein 4
  • heat shock 70kDa protein 4
  • Heat shock 70-related protein APG-2
  • heat shock protein, 110 kDa
  • HS24/P52
  • hsp70
  • hsp70RY
  • MGC131852
  • RY

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02996
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
H00010049-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00003308-B02P
Species: Hu
Applications: WB

Publications for HspA4 Antibody (H00003308-B02P) (0)

There are no publications for HspA4 Antibody (H00003308-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HspA4 Antibody (H00003308-B02P) (0)

There are no reviews for HspA4 Antibody (H00003308-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HspA4 Antibody (H00003308-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HspA4 Products

Bioinformatics Tool for HspA4 Antibody (H00003308-B02P)

Discover related pathways, diseases and genes to HspA4 Antibody (H00003308-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HspA4 Antibody (H00003308-B02P)

Discover more about diseases related to HspA4 Antibody (H00003308-B02P).
 

Pathways for HspA4 Antibody (H00003308-B02P)

View related products by pathway.

PTMs for HspA4 Antibody (H00003308-B02P)

Learn more about PTMs related to HspA4 Antibody (H00003308-B02P).
 

Research Areas for HspA4 Antibody (H00003308-B02P)

Find related products by research area.

Blogs on HspA4

There are no specific blogs for HspA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HspA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPA4
Entrez
Uniprot