HSD11B2 Recombinant Protein Antigen

Images

 
There are currently no images for HSD11B2 Protein (NBP2-37898PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HSD11B2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD11B2.

Source: E. coli

Amino Acid Sequence: GDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSD11B2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37898.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSD11B2 Recombinant Protein Antigen

  • 11 betaHSD2
  • 11 beta-HSD2
  • AME
  • corticosteroid 11-beta-dehydrogenase isozyme 2,11-beta-HSD2
  • EC 1.1.1
  • EC 1.1.1.-
  • HSD11B2
  • HSD11KAME1
  • HSD2,11-DH2
  • hydroxysteroid (11-beta) dehydrogenase 2
  • NAD-dependent 11-beta-hydroxysteroid dehydrogenase
  • SDR9C3
  • short chain dehydrogenase/reductase family 9C member 3,11-beta-hydroxysteroid dehydrogenase type 2

Background

HSD11B2 catalyzes the conversion of cortisol to the inactive metabolite cortisone. The protein modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids. Defects in HSD11B2 are the cause of apparent mineralocorticoid excess (AME). AME is a potentially fatal disease characterized by severe juvenile low-renin hypertension, sodium retention, hypokalemia and low levels of aldosterone. It often leads to nephrocalcinosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
AF3397
Species: Hu, Mu, Rt
Applications: WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
NBP2-13891
Species: Hu
Applications: IHC,  IHC-P
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP2-67344
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB7450
Species: Hu
Applications: IHC
NBP2-33903
Species: Hu
Applications: IHC,  IHC-P
291-G1
Species: Hu
Applications: BA
H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-48848
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for HSD11B2 Protein (NBP2-37898PEP) (0)

There are no publications for HSD11B2 Protein (NBP2-37898PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD11B2 Protein (NBP2-37898PEP) (0)

There are no reviews for HSD11B2 Protein (NBP2-37898PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSD11B2 Protein (NBP2-37898PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSD11B2 Products

Research Areas for HSD11B2 Protein (NBP2-37898PEP)

Find related products by research area.

Blogs on HSD11B2

There are no specific blogs for HSD11B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSD11B2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD11B2