HRSP12 Antibody

Images

 
Independent Antibodies: Western Blot: HRSP12 Antibody [NBP1-82453] - Analysis using Anti-RIDA antibody NBP1-82453 (A) shows similar pattern to independent antibody NBP1-82452 (B).
Immunohistochemistry: HRSP12 Antibody [NBP1-82453] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Western Blot: HRSP12 Antibody [NBP1-82453] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining in human liver and pancreas tissues using anti-RIDA antibody. Corresponding RIDA RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining of human kidney.
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining of human colon.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Analysis in human liver and skin tissues. Corresponding HRSP12 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining of human fallopian tube, kidney, liver and skin using Anti-HRSP12 antibody NBP1-82453 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: HRSP12 Antibody [NBP1-82453] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HRSP12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HRSP12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HRSP12 Protein (NBP1-82453PEP)
Publications
Read Publication using NBP1-82453.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22801372). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HRSP12 Antibody

  • EC 3.1
  • heat-responsive protein 12perchloric acid-soluble protein
  • P14.5
  • PSPribonuclease UK114
  • translational inhibitor protein p14.5,14.5 kDa translational inhibitor protein
  • UK114 antigen homolog
  • UK114translational inhibitor p14.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP2-37493
Species: Hu, Mu, Po
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97765
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
7954-GM/CF
Species: Hu
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
9094-AG
Species: Hu
477-MN/CF
Species: Mu
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90081
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82453
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for HRSP12 Antibody (NBP1-82453)(1)

Reviews for HRSP12 Antibody (NBP1-82453) (0)

There are no reviews for HRSP12 Antibody (NBP1-82453). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HRSP12 Antibody (NBP1-82453) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HRSP12 Products

Bioinformatics Tool for HRSP12 Antibody (NBP1-82453)

Discover related pathways, diseases and genes to HRSP12 Antibody (NBP1-82453). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HRSP12 Antibody (NBP1-82453)

Discover more about diseases related to HRSP12 Antibody (NBP1-82453).
 

Pathways for HRSP12 Antibody (NBP1-82453)

View related products by pathway.

PTMs for HRSP12 Antibody (NBP1-82453)

Learn more about PTMs related to HRSP12 Antibody (NBP1-82453).

Blogs on HRSP12

There are no specific blogs for HRSP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HRSP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HRSP12