HRSP12 Antibody

Images

 
Western Blot: HRSP12 Antibody [NBP1-57084] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HRSP12 Antibody Summary

Immunogen
Synthetic peptides corresponding to HRSP12 (heat-responsive protein 12) The peptide sequence was selected from the N terminal of HRSP12. Peptide sequence MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HRSP12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HRSP12 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HRSP12 Antibody

  • EC 3.1
  • heat-responsive protein 12perchloric acid-soluble protein
  • P14.5
  • PSPribonuclease UK114
  • translational inhibitor protein p14.5,14.5 kDa translational inhibitor protein
  • UK114 antigen homolog
  • UK114translational inhibitor p14.5

Background

HRSP12 is an endoribonuclease responsible for the inhibition of the translation by cleaving mRNA.HRSP12 inhibits cell-free protein synthesis. HRSP12 cleaves phosphodiester bonds only in single-stranded RNA.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-37493
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF4937
Species: Hu
Applications: WB, IHC
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
AF6590
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
9094-AG
Species: Hu
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP1-57084
Species: Hu
Applications: WB

Publications for HRSP12 Antibody (NBP1-57084) (0)

There are no publications for HRSP12 Antibody (NBP1-57084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HRSP12 Antibody (NBP1-57084) (0)

There are no reviews for HRSP12 Antibody (NBP1-57084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HRSP12 Antibody (NBP1-57084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HRSP12 Products

Bioinformatics Tool for HRSP12 Antibody (NBP1-57084)

Discover related pathways, diseases and genes to HRSP12 Antibody (NBP1-57084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HRSP12 Antibody (NBP1-57084)

Discover more about diseases related to HRSP12 Antibody (NBP1-57084).
 

Pathways for HRSP12 Antibody (NBP1-57084)

View related products by pathway.

PTMs for HRSP12 Antibody (NBP1-57084)

Learn more about PTMs related to HRSP12 Antibody (NBP1-57084).

Blogs on HRSP12

There are no specific blogs for HRSP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HRSP12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HRSP12
Uniprot