HRP-2 Antibody

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47438] - Staining of human cerebral cortex, gastrointestinal, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47438 (A) shows similar protein distribution across tissues to independent antibody NBP2-47437 (B).

Western Blot: HRP-2 Antibody [NBP2-47438] - Analysis in human testis tissue.

Immunocytochemistry/Immunofluorescence: HRP-2 Antibody [NBP2-47438] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47438] - Staining of human Small intestine shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47438] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47438] - Staining of human Pancreas shows strong nuclear positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47438] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HRP-2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKV
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HDGFL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HRP-2 Recombinant Protein Antigen (NBP2-47438PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HRP-2 Antibody

• HDGF Like 2
• HDGF2
• HDGF-2
• HDGFL2
• HDGF-Related Protein 2
• HDGFRP2
• Hepatoma-derived growth factor 2
• Hepatoma-Derived Growth Factor Related Protein 2
• Hepatoma-Derived Growth Factor-Related Protein 2
• HRP2
• HRP-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HRP-2 Antibody (NBP2-47438)(1)

Publication using NBP2-47438

• Ballandras-Colas A, Chivukula V, Gruszka DT et al. Multivalent interactions essential for lentiviral integrase function Nature communications 2022-05-03 [PMID: 35504909] (WB, Human, Sheep)
  
  Details:
  Fig. 8a and Fig 9b

Bioinformatics

• Gene Symbol: HDGFL2