hnRNP-R Antibody


Western Blot: hnRNP-R Antibody [NBP1-89676] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: hnRNP-R Antibody [NBP1-89676] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining in human endometrium and pancreas tissues using anti-HNRNPR antibody. Corresponding HNRNPR RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Analysis in human endometrium and pancreas tissues using Anti-HNRNPR antibody. Corresponding HNRNPR RNA-seq data are presented more
Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining of human endometrium shows high expression.
Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

hnRNP-R Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT
Specificity of human, mouse hnRNP-R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
hnRNP-R Lysate (NBP2-65987)
Control Peptide
hnRNP-R Protein (NBP1-89676PEP)
Read Publication using
NBP1-89676 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25338097).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for hnRNP-R Antibody

  • FLJ25714
  • heterogeneous nuclear ribonucleoprotein R
  • hnRNP R


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Mu, Bv
Applications: WB, ICC/IF, IHC

Publications for hnRNP-R Antibody (NBP1-89676)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for hnRNP-R Antibody (NBP1-89676) (0)

There are no reviews for hnRNP-R Antibody (NBP1-89676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hnRNP-R Antibody (NBP1-89676). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody to recognize mouse hnRNPR I see you have 2 that use almost identical immunogens but recognize proteins of different sizes? NBP1-89676 and NBP1-57158
    • The differences you are seeing between the NBP1-89676 and NBP1-57158 are most likely due to the sample used in testing. For NBP1-89676, U-251MG and RT4 cell lysates were used in the testing, whereas for NBP1-57158, a 721_B cell lysate was used. It is very possible that these cell lines express different isoforms or different levels of each isoform. Unfortunately, I do not have any data as to which cell line expresses which isoform(s) of this protein.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for hnRNP-R Antibody (NBP1-89676)

Discover related pathways, diseases and genes to hnRNP-R Antibody (NBP1-89676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP-R Antibody (NBP1-89676)

Discover more about diseases related to hnRNP-R Antibody (NBP1-89676).

Pathways for hnRNP-R Antibody (NBP1-89676)

View related products by pathway.

PTMs for hnRNP-R Antibody (NBP1-89676)

Learn more about PTMs related to hnRNP-R Antibody (NBP1-89676).

Blogs on hnRNP-R

There are no specific blogs for hnRNP-R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our hnRNP-R Antibody and receive a gift card or discount.


Gene Symbol HNRNPR