hnRNP-R Antibody

Images

 
Western Blot: hnRNP-R Antibody [NBP1-89676] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: hnRNP-R Antibody [NBP1-89676] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining of human cerebral cortex shows strong nuclear positivity in glial and neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP-R Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
hnRNP-R Protein (NBP1-89676PEP)
Publications
Read Publication using
NBP1-89676 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25338097).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hnRNP-R Antibody

  • FLJ25714
  • heterogeneous nuclear ribonucleoprotein R
  • hnRNP R
  • HNRPRhnRNP-R

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34068
Species: Hu
Applications: WB, IHC, IHC-P
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NB100-2251
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87407
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB200-342
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-30975
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-174
Species: Hu, Mu, Rt, Ma, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC

Publications for hnRNP-R Antibody (NBP1-89676)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for hnRNP-R Antibody (NBP1-89676) (0)

There are no reviews for hnRNP-R Antibody (NBP1-89676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hnRNP-R Antibody (NBP1-89676). (Showing 1 - 1 of 1 FAQ).

  1. I am looking for an antibody to recognize mouse hnRNPR I see you have 2 that use almost identical immunogens but recognize proteins of different sizes? NBP1-89676 and NBP1-57158
    • The differences you are seeing between the NBP1-89676 and NBP1-57158 are most likely due to the sample used in testing. For NBP1-89676, U-251MG and RT4 cell lysates were used in the testing, whereas for NBP1-57158, a 721_B cell lysate was used. It is very possible that these cell lines express different isoforms or different levels of each isoform. Unfortunately, I do not have any data as to which cell line expresses which isoform(s) of this protein.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP-R Products

Bioinformatics Tool for hnRNP-R Antibody (NBP1-89676)

Discover related pathways, diseases and genes to hnRNP-R Antibody (NBP1-89676). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP-R Antibody (NBP1-89676)

Discover more about diseases related to hnRNP-R Antibody (NBP1-89676).
 

Pathways for hnRNP-R Antibody (NBP1-89676)

View related products by pathway.

PTMs for hnRNP-R Antibody (NBP1-89676)

Learn more about PTMs related to hnRNP-R Antibody (NBP1-89676).

Blogs on hnRNP-R

There are no specific blogs for hnRNP-R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP-R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPR