hnRNP-R Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: hnRNP-R Antibody [NBP1-89676] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining in human endometrium and pancreas tissues using anti-HNRNPR antibody. Corresponding HNRNPR RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining of human endometrium shows high expression.

Immunohistochemistry-Paraffin: hnRNP-R Antibody [NBP1-89676] - Staining of human pancreas shows low expression as expected.

Analysis in human cell line HEK 293.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

hnRNP-R Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit hnRNP-R Antibody - BSA Free (NBP1-89676) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-hnRNP-R Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQT
• Predicted Species: Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPR
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  hnRNP-R Protein (NBP1-89676PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 25338097).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for hnRNP-R Antibody - BSA Free

• FLJ25714
• heterogeneous nuclear ribonucleoprotein R
• hnRNP R
• HNRPRhnRNP-R

Background

The hnRNP-R gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in th

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for hnRNP-R Antibody (NBP1-89676)(2)

Publications using NBP1-89676

• Alsaadi R HNRNPR Variants that Impair Homeobox Gene Expression Drive Developmental Disorders in Humans Am. J. Hum. Genet. 2019-04-24 [PMID: 31079900] (WB, Human)
• Dombert B, Sivadasan R, Simon CM et al. Presynaptic Localization of Smn and hnRNP R in Axon Terminals of Embryonic and Postnatal Mouse Motoneurons. PLoS One 2014-01-01 [PMID: 25338097] (ICC/IF, Mouse)

FAQs for hnRNP-R Antibody (NBP1-89676). (Showing 1 - 1 of 1 FAQs).

1. I am looking for an antibody to recognize mouse hnRNPR I see you have 2 that use almost identical immunogens but recognize proteins of different sizes? NBP1-89676 and NBP1-57158
   • The differences you are seeing between the NBP1-89676 and NBP1-57158 are most likely due to the sample used in testing. For NBP1-89676, U-251MG and RT4 cell lysates were used in the testing, whereas for NBP1-57158, a 721_B cell lysate was used. It is very possible that these cell lines express different isoforms or different levels of each isoform. Unfortunately, I do not have any data as to which cell line expresses which isoform(s) of this protein.

Bioinformatics

• Gene Symbol: HNRNPR