DMGDH Antibody

Images

 
Immunohistochemistry: DMGDH Antibody [NBP1-86289] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.
Immunohistochemistry: DMGDH Antibody [NBP1-86289] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DMGDH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLATDDVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPAVIIQEPLVLTEPTRNRLQK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DMGDH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DMGDH Protein (NBP1-86289PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DMGDH Antibody

  • dimethylglycine dehydrogenase
  • dimethylglycine dehydrogenase, mitochondrial
  • DMGDHD
  • EC 1.5.99.2
  • ME2GLYDH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2476
Species: Hu
Applications: WB, IHC
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-31668
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30036
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-84752
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1081
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P

Publications for DMGDH Antibody (NBP1-86289) (0)

There are no publications for DMGDH Antibody (NBP1-86289).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMGDH Antibody (NBP1-86289) (0)

There are no reviews for DMGDH Antibody (NBP1-86289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DMGDH Antibody (NBP1-86289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DMGDH Products

Bioinformatics Tool for DMGDH Antibody (NBP1-86289)

Discover related pathways, diseases and genes to DMGDH Antibody (NBP1-86289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DMGDH Antibody (NBP1-86289)

Discover more about diseases related to DMGDH Antibody (NBP1-86289).
 

Pathways for DMGDH Antibody (NBP1-86289)

View related products by pathway.

PTMs for DMGDH Antibody (NBP1-86289)

Learn more about PTMs related to DMGDH Antibody (NBP1-86289).

Blogs on DMGDH

There are no specific blogs for DMGDH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DMGDH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DMGDH