HDGFRP3 Antibody

Images

 
Western Blot: HDGFRP3 Antibody [NBP2-13246] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: HDGFRP3 Antibody [NBP2-13246] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: HDGFRP3 Antibody [NBP2-13246] - Staining of human hippocampus shows moderate nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HDGFRP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LWEIENNPGVKFTGYQAIQQQSSSETEGEGGNTADASSEEEGDRVEEDGK GKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDCKEEENKSSSEGGD AGNDTRNTTSDLQKTSEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HDGFRP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
HDGFRP3 Protein (NBP2-13246PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HDGFRP3 Antibody

  • HDGF2
  • HDGF-2
  • Hepatoma-derived growth factor 2
  • hepatoma-derived growth factor, related protein 3
  • hepatoma-derived growth factor-related protein 3
  • HRP-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-71926
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB110-40561
Species: Hu
Applications: WB, IP
AF1085
Species: Mu
Applications: WB, IHC, Neut
H00001847-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
4956-HD
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-52963
Species: Hu
Applications: WB, IHC, IHC-P
NB100-143
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB1648
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for HDGFRP3 Antibody (NBP2-13246) (0)

There are no publications for HDGFRP3 Antibody (NBP2-13246).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HDGFRP3 Antibody (NBP2-13246) (0)

There are no reviews for HDGFRP3 Antibody (NBP2-13246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HDGFRP3 Antibody (NBP2-13246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HDGFRP3 Products

Bioinformatics Tool for HDGFRP3 Antibody (NBP2-13246)

Discover related pathways, diseases and genes to HDGFRP3 Antibody (NBP2-13246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HDGFRP3 Antibody (NBP2-13246)

Discover more about diseases related to HDGFRP3 Antibody (NBP2-13246).
 

Pathways for HDGFRP3 Antibody (NBP2-13246)

View related products by pathway.

Research Areas for HDGFRP3 Antibody (NBP2-13246)

Find related products by research area.

Blogs on HDGFRP3

There are no specific blogs for HDGFRP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HDGFRP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HDGFRP3