![Immunocytochemistry/Immunofluorescence: HRP-2 Antibody [NBP2-47437] - Staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-47437-img0003.jpg "Immunocytochemistry/Immunofluorescence: HRP-2 Antibody [NBP2-47437] - Staining of human cell line A-431 shows localization to nucleoplasm.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit HRP-2 Antibody - BSA Free (NBP2-47437) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HDGFL2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HRP-2 Antibody (NBP2-47437)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HDGFL2 |
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Small intestine shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0012.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Small intestine shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry: HRP-2 Antibody [NBP2-47437] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-NBP2-47437-img0002.jpg "Immunohistochemistry: HRP-2 Antibody [NBP2-47437] - Staining of human stomach, upper shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, colon, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0004.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, colon, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human testis.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0005.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human testis.")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human pancreas.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0006.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human pancreas.")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0007.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human colon.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0008.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human colon.")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0009.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Cerebral cortex shows strong nuclear positivity in neuronal and glial cells.")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, gastrointestinal, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0010.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human cerebral cortex, gastrointestinal, pancreas and testis using Anti-CTB-50L17.10 antibody NBP2-47437 (A) shows similar protein distribution across tissues to independent antibody NBP2-47438 (B).")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Pancreas shows strong nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0011.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Pancreas shows strong nuclear positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/HRP-2-Antibody-Immunohistochemistry-Paraffin-NBP2-47437-img0013.jpg "Immunohistochemistry-Paraffin: HRP-2 Antibody [NBP2-47437] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12543.jpg)
![Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12613.jpg)
![Neutralization Siglec-7/CD328 Antibody [Unconjugated]](https://images.novusbio.com/images2/Siglec-7_AF1138_Block_Neutralize_8760.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/TNF_RII_DRT200_ELISA_176.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_817.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_818.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")