Hrk Antibody - BSA Free

Western Blot: Hrk Antibody [NBP1-59447] - Human Thymus lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Hrk Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to HRK(harakiri, BCL2 interacting protein (contains only BH3 domain)) The peptide sequence was selected from the N terminal of HRK. Peptide sequence MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMW. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HRK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Hrk Antibody - BSA Free

• activator of apoptosis harakiri
• activator of apoptosis Hrk
• BCL2-interacting protein
• BH3-interacting domain-containing protein 3
• BID3
• death protein 5
• DP5
• HARAKIRI
• harakiri, BCL2 interacting protein (contains only BH3 domain)
• harakiri, BCL2-interacting protein (contains only BH3 domain)
• Hrk
• Neuronal death protein DP5

Background

Activator of apoptosis Hrk regulates apoptosis through interaction with death-repressor proteins Bcl-2 and Bcl-X(L). The HRK protein lacks significant homology to other BCL2 family members except for an 8-amino acid region that was similar to the BCL2 hom

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Hrk Antibody (NBP1-59447)(1)

Publication using NBP1-59447

• Yahiro K, Ogura K, Tsutsuki H et al. A novel endoplasmic stress mediator, Kelch domain containing 7B (KLHDC7B), increased Harakiri (HRK) in the SubAB-induced apoptosis signaling pathway Cell Death Discovery 2021-11-19 [PMID: 34799565] (Immunoprecipitation, Western Blot)

Review for Hrk Antibody (NBP1-59447) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 07/30/2023

Summary

• Application: Western Blot
• Sample Tested: human melanoma
• Species: Human
• Lot: QC16525-190621

Comments

• Comments: ***Bio-Techne Response: Thank you for reviewing our product. We are sorry to hear that this product did not perform as expected. We have been in touch with the customer to resolve this issue according to our Product Guarantee and to the customer’s satisfaction.***

Bioinformatics

• Gene Symbol: HRK
• Uniprot:
  • O00198(Human)