HRD1 Recombinant Protein Antigen

Images

 
There are currently no images for HRD1 Protein (NBP1-89667PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HRD1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYVN1.

Source: E.coli

Amino Acid Sequence: PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SYVN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89667.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HRD1 Recombinant Protein Antigen

  • E3 ubiquitin-protein ligase synoviolin
  • EC 6.3.2
  • HRD1EC 6.3.2.-
  • KIAA1810Synovial apoptosis inhibitor 1
  • MGC40372
  • synovial apoptosis inhibitor 1, synoviolin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-15374
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76965
Species: Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-43760
Species: Hu
Applications: WB, ICC/IF, IHC-Fr, IHC-P
NB120-11929
Species: Hu, Mu
Applications: WB, Flow
NBP1-06274
Species: Hu, Mu, Rt, Ce, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IHC-FrFl
NBP2-45402
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC
NBP1-40256
Species: Hu, Mu, Rt, Po, Pl, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, KO
NBP2-46278
Species: Hu, Mu, Ca, Pm
Applications: WB, IHC, IF
NBP1-06088
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-89667PEP
Species: Hu
Applications: AC

Publications for HRD1 Protein (NBP1-89667PEP) (0)

There are no publications for HRD1 Protein (NBP1-89667PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HRD1 Protein (NBP1-89667PEP) (0)

There are no reviews for HRD1 Protein (NBP1-89667PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HRD1 Protein (NBP1-89667PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional HRD1 Products

Bioinformatics Tool for HRD1 Protein (NBP1-89667PEP)

Discover related pathways, diseases and genes to HRD1 Protein (NBP1-89667PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HRD1 Protein (NBP1-89667PEP)

Discover more about diseases related to HRD1 Protein (NBP1-89667PEP).
 

Pathways for HRD1 Protein (NBP1-89667PEP)

View related products by pathway.

PTMs for HRD1 Protein (NBP1-89667PEP)

Learn more about PTMs related to HRD1 Protein (NBP1-89667PEP).
 

Research Areas for HRD1 Protein (NBP1-89667PEP)

Find related products by research area.

Blogs on HRD1.

OS9: Taking proteins to the ER finish line
The OS9 protein is a lectin/glycoprotein that maintains endoplasmic reticulum (ER) quality control and ER-associated degradation (the so-called ERAD pathway) of newly synthesized proteins. It is essential for the recognition of terminally misfolded no...  Read full blog post.

Customers Who Bought This Also Bought

ATF6 Antibody (70B1413.1)
NBP1-40256-0.1mg
HRD1 Antibody
NB100-2526

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HRD1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SYVN1