HRD1 Antibody (4H4) - Azide and BSA Free

Western Blot: HRD1 Antibody (4H4) [H00084447-M01] - Analysis of SYVN1 expression in transfected 293T cell line by SYVN1 monoclonal antibody (M01), clone 4H4.Lane 1: SYVN1 transfected lysate(67.685 KDa).Lane 2: Non-transfected lysate.

ELISA: HRD1 Antibody (4H4) [H00084447-M01] - Detection limit for recombinant GST tagged SYVN1 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4H4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HRD1 Antibody (4H4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse HRD1 Antibody (4H4) - Azide and BSA Free (H00084447-M01) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SYVN1 (NP_079434, 238 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HTFPLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVTGAKRLPCNHIFHTSCLRS
• Specificity: Reacts with synovial apoptosis inhibitor 1, synoviolin.
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SYVN1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HRD1 Antibody (4H4) - Azide and BSA Free

• E3 ubiquitin-protein ligase synoviolin
• EC 6.3.2
• HRD1EC 6.3.2.-
• KIAA1810Synovial apoptosis inhibitor 1
• MGC40372
• synovial apoptosis inhibitor 1, synoviolin

Background

This gene encodes a protein involved in endoplasmic reticulum (ER)-associated degradation. The encoded protein removes unfolded proteins, accumulated during ER stress, by retrograde transport to the cytosol from the ER. This protein also uses the ubiquitin-proteasome system for additional degradation of unfolded proteins. This gene and the mitochondrial ribosomal protein L49 gene use in their respective 3' UTRs some of the same genomic sequence. Sequence analysis identified two transcript variants that encode different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYVN1
• Entrez:
  • 84447(Human)
• Uniprot:
  • NP_115807(Human)