![Western Blot: HPSE2 Antibody [NBP3-05028] - Analysis of extracts of various cell lines, using HPSE2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit](http://images.novusbio.com/fullsize2/HPSE2-Antibody-Western-Blot-NBP3-05028-img0002.jpg "Western Blot: HPSE2 Antibody [NBP3-05028] - Analysis of extracts of various cell lines, using HPSE2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 42-242 of human HPSE2 (NP_068600.4). GDRRPLPVDRAAGLKEKTLILLDVSTKNPVRTVNENFLSLQLDPSIIHDGWLDFLSSKRLVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKEQFSNTYSNLILTARSLDKLYNFADCSGLHLIFALNALRRNPNNSWNSSSAL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HPSE2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
-Immunohistochemistry-Paraffin-NB100-174-img0015.jpg)
-Immunoprecipitation-NB100-174-img0016.jpg)
-Immunocytochemistry-Immunofluorescence-NB100-174-img0017.jpg)
![Western Blot AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-78159-img0005.jpg)
-Immunohistochemistry-NBP1-78159-img0006.jpg)
-Immunocytochemistry-Immunofluorescence-NBP1-78159-img0007.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for HPSE2 Antibody (NBP3-05028)Discover more about diseases related to HPSE2 Antibody (NBP3-05028).
| Pathways for HPSE2 Antibody (NBP3-05028)View related products by pathway.
|
PTMs for HPSE2 Antibody (NBP3-05028)Learn more about PTMs related to HPSE2 Antibody (NBP3-05028).
| Research Areas for HPSE2 Antibody (NBP3-05028)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HPSE2 |
![Immunohistochemistry-Paraffin: HPSE2 Antibody [NBP3-05028] - Human prostate using HPSE2 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize2/HPSE2-Antibody-Immunohistochemistry-Paraffin-NBP3-05028-img0001.jpg "Immunohistochemistry-Paraffin: HPSE2 Antibody [NBP3-05028] - Human prostate using HPSE2 antibody at dilution of 1:100 (40x lens).")
![Enzyme Activity Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-enzyme-activity-202202316147.jpg)
![SDS-PAGE Heparanase/HPSE [Unconjugated]](https://images.novusbio.com/images2/7570-gh_recombinant-human-active-heparanase-hpse-protein-cf-sds-page-2022023162028.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
-Western-Blot-H00009033-M01-img0001.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Flow Cytometry VEGFR3/Flt-4 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R3_AF743_Flow_Cytometry_15754.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
-Western-Blot-NB120-495-img0006.jpg)
-Immunohistochemistry-NB120-495-img0001.jpg)
-Western-Blot-NB120-495-img0003.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")