HOXB13 Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-48778] - Staining in human prostate and liver tissues using anti-HOXB13 antibody. Corresponding HOXB13 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-48778] - Staining of human colon, liver, prostate and rectum using Anti-HOXB13 antibody NBP2-48778 (A) shows similar protein ...read more
Immunocytochemistry/ Immunofluorescence: HOXB13 Antibody [NBP2-48778] - Staining of human cell line PC-3 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-48778] - Staining of human rectum.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-48778] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-48778] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: HOXB13 Antibody [NBP2-48778] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

HOXB13 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRR
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOXB13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HOXB13 Recombinant Protein Antigen (NBP2-48778PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXB13 Antibody - BSA Free

  • homeo box B13
  • homeobox B13
  • homeobox protein Hox-B13
  • HOXB13
  • PSGD

Background

HOXB13 is a novel member of the AbdB subfamily of vertebrate HOX genes which are clustered in 4 unlinked complexes in the genome (HOXA, HOXB, HOXC, and HOXD clusters) which each span about 200 kb and contains 9 to 11 genes, transcribed from the same strand of DNA. The order of the HOX genes along the chromosome correlates with their expression along the anterior/posterior axis of the embryo and suggests that their organization is integral to their proper regulation. Members of the Abdominal B (AbdB) subfamily of homeobox genes exhibit posterior domains of expression, including the developing urogenital system, in vertebrates. Several HOXB genes have been described in humans and other mammals though it was thought that HOXB genes 10 through 13 had been lost in evolution until HOXB13 was discovered. HOXB13 gene contains 2 exons and encodes a 284-amino acid protein, 2 residues shorter than the mouse protein. It is separated from HOXB9 by 70 kb but is transcribed in the same orientation as the other HOXB genes. The 60-amino acid homeodomain, located near the C terminus of the protein, demonstrated 78 to 83% identity with HOX proteins in paralog group 13 of the AbdB subfamily; 6 of the amino acid differences from other member of this group represented conservative changes. HOXB13 had less than 60% identity to other AbdB-related genes. Mouse Hoxb13 is expressed first in the tailbud of embryonic mice and subsequently in the hindgut, urogenital tract, and the posterior extent of the spinal cord. It is not expressed in the secondary axes. During the first 2 trimesters of development, wound healing occurs without scars. Two homeobox genes, PRX2 and HOXB13, are differentially expressed during fetal versus adult wound healing. Both genes are expressed in proliferating fibroblasts and fetal dermis, but not in adult dermis. The HOXB13 gene has been mapped to human chromosome 17q21.2, where other HOXB genes are clustered, whilst the mouse Hoxb13 gene mapped to chromosome 11.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1207
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NB100-1828
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, KD, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF262
Species: Hu
Applications: ICC, IHC, Neut, WB
NB300-131
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-87508
Species: Hu
Applications: IHC,  IHC-P, WB
H00003216-M01-100ug
Species: Hu
Applications: ELISA, WB
H00003217-M03
Species: Hu, Rb
Applications: ELISA, Func, IHC,  IHC-P, WB
345-FG
Species: Hu
Applications: BA
NBP3-15720
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP3-17383
Species: Hu
Applications: ICC/IF,  IHC-P
AF6318
Species: Hu
Applications: ICC
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-80893
Species: Hu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P
NBP2-87596
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for HOXB13 Antibody (NBP2-48778) (0)

There are no publications for HOXB13 Antibody (NBP2-48778).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXB13 Antibody (NBP2-48778) (0)

There are no reviews for HOXB13 Antibody (NBP2-48778). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HOXB13 Antibody (NBP2-48778) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXB13 Products

Research Areas for HOXB13 Antibody (NBP2-48778)

Find related products by research area.

Blogs on HOXB13

There are no specific blogs for HOXB13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXB13 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXB13