HOP Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HOPX |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:2500 - 1:5000
- Immunohistochemistry-Paraffin 1:2500 - 1:5000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for HOP Antibody - BSA Free
Background
HOP, also known as Homeodomain-only protein, has a 73 amino acid short isoform that is 8 kDa and a long 94 amino acid isoform that is 10 kDa; nucleus located; widely expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen; may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development; prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF; overexpression causes cardiac hypertrophy; and may also act as a tumor suppressor. Disease research is currently being studied with relation to choriocarcinoma, abdominal actinomycosis, nevus of ota, actinomycosis, lung cancer, nevus, carcinoma, squamous cell carcinoma, oral squamous cell carcinoma, esophageal squamous cell carcinoma, dilated cardiomyopathy, thyroid carcinoma, endometrial cancer, cardiomyopathy, gastric cancer, glioblastoma, esophagitis, and thyroiditis. This protein has shown an interaction with HDAC2, EPC1, SRF, GZMB, HOXB9, TLX3, and ZSCAN1 in the negative regulation of transcription from RNA polymerase II promoter, trophectodermal cell differentiation, transcription, DNA-dependent, regulation of transcription, DNA-dependent, and multicellular organismal development pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Mu
Applications: WB
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Publications for HOP Antibody (NBP1-92003)(1)
Showing Publication 1 -
1 of 1.
Reviews for HOP Antibody (NBP1-92003) (0)
There are no reviews for HOP Antibody (NBP1-92003).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for HOP Antibody (NBP1-92003) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOP Products
Research Areas for HOP Antibody (NBP1-92003)
Find related products by research area.
|
Blogs on HOP