HOP Antibody - BSA Free

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003] - Staining in human skin and liver tissues . Corresponding HOPX RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003] - Staining of human cervix, uterine shows moderate positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: HOP Antibody [NBP1-92003] - Staining of human skin shows moderate positivity in stratum granulosum.

Analysis in human skin and liver tissues using NBP1-92003 antibody. Corresponding HOPX RNA-seq data are presented for the same tissues.

ChIP-Exo-Seq composite graph for Anti-HOPX (NBP1-92003) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLIFLGCYRRRLEERAGTMSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOPX
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HOP Protein (NBP1-92003PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HOP Antibody - BSA Free

• CAMEO
• HOD
• homeodomain-only protein
• HOP homeobox
• HOPLAGYNECC1OB1SMAP31
• Lung cancer-associated Y protein
• MGC20820
• not expressed in choriocarcinoma clone 1
• Not expressed in choriocarcinoma protein 1
• odd homeobox 1 protein
• Odd homeobox protein 1
• TOTO

Background

HOP, also known as Homeodomain-only protein, has a 73 amino acid short isoform that is 8 kDa and a long 94 amino acid isoform that is 10 kDa; nucleus located; widely expressed in the heart, brain, placenta, lung, skeletal and smooth muscles, uterus, urinary bladder, kidney and spleen; may interact with serum response factor (SRF) and modulate SRF-dependent cardiac-specific gene expression and cardiac development; prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF; overexpression causes cardiac hypertrophy; and may also act as a tumor suppressor. Disease research is currently being studied with relation to choriocarcinoma, abdominal actinomycosis, nevus of ota, actinomycosis, lung cancer, nevus, carcinoma, squamous cell carcinoma, oral squamous cell carcinoma, esophageal squamous cell carcinoma, dilated cardiomyopathy, thyroid carcinoma, endometrial cancer, cardiomyopathy, gastric cancer, glioblastoma, esophagitis, and thyroiditis. This protein has shown an interaction with HDAC2, EPC1, SRF, GZMB, HOXB9, TLX3, and ZSCAN1 in the negative regulation of transcription from RNA polymerase II promoter, trophectodermal cell differentiation, transcription, DNA-dependent, regulation of transcription, DNA-dependent, and multicellular organismal development pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOP Antibody (NBP1-92003)(1)

Publication using NBP1-92003

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: HOPX