We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

hnRNP U Antibody - BSA Free

Images

 
Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Rat testis using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with ...read more
Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with ...read more
Immunocytochemistry/ Immunofluorescence: hnRNP U Antibody [NBP3-38059] - Immunofluorescence analysis of C6 cells using hnRNP U Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG ...read more
Western Blot: hnRNP U Antibody [NBP3-38059] - Western blot analysis of various lysates using hnRNP U Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval ...read more
Immunoprecipitation: hnRNP U Antibody [NBP3-38059] - Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug hnRNP U antibody. Western blot was performed from the immunoprecipitate using hnRNP U ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

hnRNP U Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 608-825 of human hnRNP U (NP_114032.2).

Sequence:
PKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPU
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
Theoretical MW
91 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for hnRNP U Antibody - BSA Free

  • heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
  • heterogeneous nuclear ribonucleoprotein U
  • hnRNP U
  • HNRPU
  • p120 nuclear protein
  • p120
  • pp120
  • SAFA
  • SAF-AhnRNPU
  • Scaffold attachment factor A
  • U21.1

Background

hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-12897
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-81038
Species: Bv, Hu, Po, Sh
Applications: ELISA, Flow, ICC/IF, IHC, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-76855
Species: Hu
Applications: ELISA, ICC/IF, WB
MPTX20
Species: Mu
Applications: ELISA
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, IM, KD, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24459
Species: Ca, Ch, Hu, Mu, Pm, Rb, Rt, RM, Xp, Ze
Applications: ICC/IF, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA

Publications for hnRNP U Antibody (NBP3-38059) (0)

There are no publications for hnRNP U Antibody (NBP3-38059).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP U Antibody (NBP3-38059) (0)

There are no reviews for hnRNP U Antibody (NBP3-38059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hnRNP U Antibody (NBP3-38059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP U Products

Research Areas for hnRNP U Antibody (NBP3-38059)

Find related products by research area.

Blogs on hnRNP U

There are no specific blogs for hnRNP U, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP U Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPU