hnRNP U Antibody - BSA Free

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Rat testis using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: hnRNP U Antibody [NBP3-38059] - Immunofluorescence analysis of C6 cells using hnRNP U Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: hnRNP U Antibody [NBP3-38059] - Western blot analysis of various lysates using hnRNP U Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

Immunohistochemistry: hnRNP U Antibody [NBP3-38059] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using hnRNP U Rabbit pAb at dilution of 1:50 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunoprecipitation: hnRNP U Antibody [NBP3-38059] - Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug hnRNP U antibody. Western blot was performed from the immunoprecipitate using hnRNP U antibody at a dilution of 1:1000.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

hnRNP U Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 608-825 of human hnRNP U (NP_114032.2).
  
  Sequence:
  PKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPU
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 91 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for hnRNP U Antibody - BSA Free

• heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
• heterogeneous nuclear ribonucleoprotein U
• hnRNP U
• HNRPU
• p120 nuclear protein
• p120
• pp120
• SAFA
• SAF-AhnRNPU
• Scaffold attachment factor A
• U21.1

Background

hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPU