hnRNP U Antibody - BSA Free

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Immunohistochemistry: hnRNP U Antibody [NBP2-48729] - Staining of human bronchus shows strong nuclear positivity in respiratory epithelial cells.

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-48729] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Immunohistochemistry: hnRNP U Antibody [NBP2-48729] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

hnRNP U Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDT
• Predicted Species: Mouse (100%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPU
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  hnRNP U Recombinant Protein Antigen (NBP2-48729PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for hnRNP U Antibody - BSA Free

• heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
• heterogeneous nuclear ribonucleoprotein U
• hnRNP U
• HNRPU
• p120 nuclear protein
• p120
• pp120
• SAFA
• SAF-AhnRNPU
• Scaffold attachment factor A
• U21.1

Background

hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPU