We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human HNF-4 alpha/NR2A1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human HNF-4 alpha/NR2A1 Protein [H00003172-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Recombinant Human HNF-4 alpha/NR2A1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 324-423 of Human HNF-4 alpha/NR2A1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HNF4A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HNF-4 alpha/NR2A1 GST (N-Term) Protein

  • FLJ39654
  • hepatic nuclear factor 4 alpha
  • hepatocyte nuclear factor 4, alpha
  • hepatocyte nuclear factor 4-alpha
  • HNF4 alpha
  • HNF-4 alpha
  • HNF4A
  • HNF4a7
  • HNF-4-alpha
  • HNF4alpha10/11/12
  • HNF4HNF4a8
  • MODY
  • MODY1
  • NR2A1
  • NR2A1HNF4a9
  • NR2A21
  • Nuclear receptor subfamily 2 group A member 1
  • TCF
  • TCF14
  • TCF-14
  • TCF14HNF4alpha
  • Transcription factor 14
  • Transcription factor HNF-4
  • transcription factor-14

Background

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. HNF4A( NP_000448, 324 a.a. - 424 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-89680
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86960
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
AF4186
Species: Hu
Applications: ICC, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF3287
Species: Hu, Mu, Rt
Applications: WB
MAB8224
Species: Mu
Applications: CyTOF-ready, ICFlow, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
AF4885
Species: Mu
Applications: IP, WB
H00003172-Q01
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for HNF-4 alpha/NR2A1 Partial Recombinant Protein (H00003172-Q01) (0)

There are no publications for HNF-4 alpha/NR2A1 Partial Recombinant Protein (H00003172-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-4 alpha/NR2A1 Partial Recombinant Protein (H00003172-Q01) (0)

There are no reviews for HNF-4 alpha/NR2A1 Partial Recombinant Protein (H00003172-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HNF-4 alpha/NR2A1 Partial Recombinant Protein (H00003172-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HNF-4 alpha/NR2A1 Products

Research Areas for HNF-4 alpha/NR2A1 Partial Recombinant Protein (H00003172-Q01)

Find related products by research area.

Blogs on HNF-4 alpha/NR2A1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human HNF-4 alpha/NR2A1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF4A