Recombinant Human HNF-4 alpha/NR2A1 GST (N-Term) Protein

SDS-Page: Recombinant Human HNF-4 alpha/NR2A1 Protein [H00003172-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human HNF-4 alpha/NR2A1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 324-423 of Human HNF-4 alpha/NR2A1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: HNF4A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human HNF-4 alpha/NR2A1 GST (N-Term) Protein

• FLJ39654
• hepatic nuclear factor 4 alpha
• hepatocyte nuclear factor 4, alpha
• hepatocyte nuclear factor 4-alpha
• HNF4 alpha
• HNF-4 alpha
• HNF4A
• HNF4a7
• HNF-4-alpha
• HNF4alpha10/11/12
• HNF4HNF4a8
• MODY
• MODY1
• NR2A1
• NR2A1HNF4a9
• NR2A21
• Nuclear receptor subfamily 2 group A member 1
• TCF
• TCF14
• TCF-14
• TCF14HNF4alpha
• Transcription factor 14
• Transcription factor HNF-4
• transcription factor-14

Background

The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. HNF4A( NP_000448, 324 a.a. - 424 a.a.) partial recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: HNF4A