HMGB1/HMG-1 Antibody (1C4T5)

Western Blot: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Western blot analysis of lysates from wild type (WT) and HMGB1/HMG-1 knockout (KO) HeLa cells using [KO Validated] HMGB1/HMG-1 Rabbit mAb at 1:6000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 0.5s.

Immunocytochemistry/Immunofluorescence: HMGB1/HMG-1 Antibody (1C4T5) [NBP3-15755] - Confocal imaging of NIH-3T3 cells using [KO Validated] HMGB1 Rabbit mAb (dilution 1:100) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Rat liver using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse colon using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: HMGB1/HMG-1 Antibody (1C4T5) [HMGB1/HMG-1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using [KO Validated] HMGB1/HMG-1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: HMGB1/HMG-1 Antibody (1C4T5) [NBP3-15755] - Western blot analysis of various lysates using [KO Validated] HMGB1/HMG-1 Rabbit mAb at 1:6000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 0.5s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KO
• Clone: 1C4T5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

HMGB1/HMG-1 Antibody (1C4T5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1/HMG-1 (P09429). SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: HMGB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Knockout Validated
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HMGB1/HMG-1 Antibody (1C4T5)

• Amphoterin
• high mobility group box 1
• High mobility group protein 1
• high mobility group protein B1
• high-mobility group (nonhistone chromosomal) protein 1
• high-mobility group box 1
• HMG1
• HMG-1
• HMG1DKFZp686A04236
• HMG3
• HMGB1
• SBP-1
• Sulfoglucuronyl carbohydrate binding protein

Background

HMGB1 and HMGB2 are part of the chromatin non-histone high mobility group proteins 1 and 2. HMGB1 and HMGB2 (containing multiple HMG-boxes) are conserved domains of 80 amino acids which mediate the DNA binding of many proteins. HMG box domains recognize DNA structure. Both HMGB1 and HMGB2 contain a N-terminal HMG box, a central HMG box, and an acidic carboxy terminus. The acidic tails of HMGB1 and HMGB2 contain multiple serine residues which match the phosphorylation consensus sites of casein kinase II, and phosphorylation of this domain appears to be important for proper functioning of these proteins. HMGB1 and HMGB2 have been shown to facilitate the binding of various sequence-specific transcription factors to their respective DNA binding sites. HMGB1 and HMGB2 may also serve as architectural factors that recognize and mediate DNA structural changes that accompany various events such as DNA repair, transcription, and replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGB1