HLA DQ3 Antibody - BSA Free

Western Blot: HLA DQ3 Antibody [NBP2-84068] - Host: Rabbit. Target Name: HLA-DQA1. Sample Tissue: Human Mesenchymoma Tumor lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HLA DQ3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HLA DQ3 Antibody - BSA Free (NBP2-84068) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLA DQ3. Peptide sequence: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-DQA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HLA DQ3 Antibody - BSA Free

• CD
• CELIAC1DQ alpha 1 chain
• DC-1 alpha chain
• DQ-A1
• FLJ27088
• FLJ27328
• GSE
• HLA class II histocompatibility antigen, DQ(W3) alpha chain
• HLA-DCA
• HLA-DQA
• leucocyte antigen DQA1
• leukocyte antigen alpha chain
• major histocompatibility complex, class II, DQ alpha 1
• MGC149527
• MHC class II antigen
• MHC class II DQA1
• MHC class II HLA-D alpha glycoprotein
• MHC class II HLA-DQ-alpha-1
• MHC class II surface glycoprotein
• MHC HLA-DQ alpha

Background

Human Leukocyte Antigens are highly polymorphic proteins that are involved in the presentation of antigens to the T cell receptor. There are two classes of HLA antigens, class I (HLA A, HLA B and HLA C) and class II (HLA D). This antibody can be used for HLA typing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-DQA1