HLA DPA Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HLA DPA Antibody [NBP1-89689] - Staining of human cell line A-431 shows positivity in vesicles.
Immunohistochemistry-Paraffin: HLA DPA Antibody [NBP1-89689] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HLA DPA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DPA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HLA DPA Protein (NBP1-89689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLA DPA Antibody

  • DP alpha 1 chain
  • HLA class II histocompatibility antigen, DP alpha chain
  • HLADP
  • HLA-SB alpha chain
  • major histocompatibility complex, class II, DP alpha 1
  • MHC class II antigen
  • MHC class II DP3-alpha
  • MHC class II DPA1
  • MHC class II HLA-DPA1 antigen
  • Primed lymphocyte test-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P, MeDIP
NBP1-89689
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HLA DPA Antibody (NBP1-89689) (0)

There are no publications for HLA DPA Antibody (NBP1-89689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DPA Antibody (NBP1-89689) (0)

There are no reviews for HLA DPA Antibody (NBP1-89689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HLA DPA Antibody (NBP1-89689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DPA Products

Bioinformatics Tool for HLA DPA Antibody (NBP1-89689)

Discover related pathways, diseases and genes to HLA DPA Antibody (NBP1-89689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DPA Antibody (NBP1-89689)

Discover more about diseases related to HLA DPA Antibody (NBP1-89689).
 

Pathways for HLA DPA Antibody (NBP1-89689)

View related products by pathway.

PTMs for HLA DPA Antibody (NBP1-89689)

Learn more about PTMs related to HLA DPA Antibody (NBP1-89689).
 

Research Areas for HLA DPA Antibody (NBP1-89689)

Find related products by research area.

Blogs on HLA DPA

There are no specific blogs for HLA DPA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DPA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DPA1