HLA DOB Antibody

Images

 
Western Blot: HLA DOB Antibody [H00003112-B01P] - Analysis of HLA-DOB expression in human liver.
Western Blot: HLA DOB Antibody [H00003112-B01P] - Analysis of HLA-DOB expression in transfected 293T cell line by HLA-DOB polyclonal antibody. Lane 1: HLA-DOB transfected lysate(30.03 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLA DOB Antibody Summary

Immunogen
HLA-DOB (NP_002111.1, 1 a.a. - 273 a.a.) full-length human protein. MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWTFQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLLVGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
Specificity
HLA-DOB - major histocompatibility complex, class II, DO beta,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HLA-DOB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DOB Antibody

  • DOB
  • FLJ57033
  • HLA class II histocompatibility antigen, DO beta chain
  • major histocompatibility complex, class II, DO beta
  • MHC class II antigen DOB

Background

HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91993
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
AF2864
Species: Hu
Applications: WB, ICC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBP1-85326
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84450
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF2898
Species: Mu
Applications: WB, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for HLA DOB Antibody (H00003112-B01P) (0)

There are no publications for HLA DOB Antibody (H00003112-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DOB Antibody (H00003112-B01P) (0)

There are no reviews for HLA DOB Antibody (H00003112-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DOB Antibody (H00003112-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DOB Products

Bioinformatics Tool for HLA DOB Antibody (H00003112-B01P)

Discover related pathways, diseases and genes to HLA DOB Antibody (H00003112-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DOB Antibody (H00003112-B01P)

Discover more about diseases related to HLA DOB Antibody (H00003112-B01P).
 

Pathways for HLA DOB Antibody (H00003112-B01P)

View related products by pathway.

Research Areas for HLA DOB Antibody (H00003112-B01P)

Find related products by research area.

Blogs on HLA DOB

There are no specific blogs for HLA DOB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DOB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DOB
Entrez
Uniprot