HLA DMA Antibody

Images

 
Western Blot: HLA DMA Antibody [NBP1-85325] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HLA DMA Antibody [NBP1-85325] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HLA DMA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DMA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HLA DMA Protein (NBP1-85325PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLA DMA Antibody

  • class II histocompatibility antigen, M alpha chain
  • D6S222E
  • DMA
  • HLA class II histocompatibility antigen, DM alpha chain
  • major histocompatibility complex, class II, DM alpha
  • MHC class II antigen DMA
  • Really interesting new gene 6 protein
  • RING6HLADM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55515
Species: Hu
Applications: ICC/IF
NBP1-85326
Species: Hu
Applications: WB, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC
MAB6967
Species: Hu
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NB100-1131
Species: Hu, ArHa
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31769
Species: Hu
Applications: IHC, IHC-P
NBP1-85325
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HLA DMA Antibody (NBP1-85325) (0)

There are no publications for HLA DMA Antibody (NBP1-85325).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DMA Antibody (NBP1-85325) (0)

There are no reviews for HLA DMA Antibody (NBP1-85325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DMA Antibody (NBP1-85325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DMA Products

Bioinformatics Tool for HLA DMA Antibody (NBP1-85325)

Discover related pathways, diseases and genes to HLA DMA Antibody (NBP1-85325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DMA Antibody (NBP1-85325)

Discover more about diseases related to HLA DMA Antibody (NBP1-85325).
 

Pathways for HLA DMA Antibody (NBP1-85325)

View related products by pathway.

PTMs for HLA DMA Antibody (NBP1-85325)

Learn more about PTMs related to HLA DMA Antibody (NBP1-85325).
 

Research Areas for HLA DMA Antibody (NBP1-85325)

Find related products by research area.

Blogs on HLA DMA

There are no specific blogs for HLA DMA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DMA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DMA