HLA A2 Antibody - BSA Free

Western Blot: HLA A2 Antibody [NBP2-84067] - Host: Rabbit. Target Name: HLA-A. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HLA A2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HLA A2. Peptide sequence: QPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HLA A2 Antibody - BSA Free

• A-10 alpha chain
• FLJ26655
• HLA class I histocompatibility antigen, A-1 alpha chain
• HLA class I histocompatibility antigen, A-28 alpha chain
• HLA class I histocompatibility antigen, A-9 alpha chain
• HLAA
• major histocompatibility complex, class I, A
• MHC class I antigen A*1
• MHC class I antigen A*11
• MHC class I antigen A*80

Background

Human leukocyte antigens are highly polymorphic proteins that are involved in the presentation of antigens to the T cell receptor. There are two classes of HLA antigens, class I (HLA A, HLA B and HLA C) and class II (HLA D).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-A