HLA A Antibody

Western Blot: HLA A Antibody [H00003105-D01P] - Analysis of HLA-A expression in human spleen.

Immunocytochemistry/Immunofluorescence: HLA A Antibody [H00003105-D01P] - Analysis of antibody to HLA-A on HeLa cell. Antibody concentration 30 ug/ml.

Western Blot: HLA A Antibody [H00003105-D01P] - Analysis of HLA-A expression in transfected 293T cell line by HLA-A polyclonal antibody.Lane 1: HLA-A transfected lysate(40.80 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

HLA A Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HLA-A (NP_002107.3, 1 a.a. - 365 a.a.) full-length human protein. MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
• Specificity: Reacts with major histocompatibility complex, class I, A.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA A Antibody

• A-10 alpha chain
• FLJ26655
• HLA class I histocompatibility antigen, A-1 alpha chain
• HLA class I histocompatibility antigen, A-28 alpha chain
• HLA class I histocompatibility antigen, A-9 alpha chain
• HLAA
• major histocompatibility complex, class I, A
• MHC class I antigen A*1
• MHC class I antigen A*11
• MHC class I antigen A*80

Background

HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-A
• Uniprot:
  • NP_002107.3(Human)