HID1 Antibody

Images

 
Western Blot: HID1 Antibody [NBP1-84075] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: HID1 Antibody [NBP1-84075] - Staining of human esophagus shows strong cytoplasmic positivity in superficial squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HID1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HID1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HID1 Protein (NBP1-84075PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HID1 Antibody

  • C17orf28
  • chromosome 17 open reading frame 28
  • DMC1
  • DMC1FLJ43526
  • downregulated in multiple cancer 1
  • Down-regulated in multiple cancers 1
  • HID-1
  • hypothetical protein LOC283987

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-58172
Species: Hu
Applications: WB
NBP1-92301
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-176
Species: Hu, Pm, Mu(-)
Applications: WB, ICC/IF
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NB300-232
Species: Mu, Rt, Po, Bv, Ch, Fe, Pa
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00084057-T01
Species: Hu
NBP2-58116
Species: Hu
Applications: ICC/IF
MAB2476
Species: Hu
Applications: WB, IHC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24457
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP1-83416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90240
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB100-165
Species: Hu, Dr
Applications: ICC/IF (-), WB, IP
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-177
Species: Hu, Mu, Pm, Ye
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for HID1 Antibody (NBP1-84075) (0)

There are no publications for HID1 Antibody (NBP1-84075).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HID1 Antibody (NBP1-84075) (0)

There are no reviews for HID1 Antibody (NBP1-84075). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HID1 Antibody (NBP1-84075) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HID1 Products

Bioinformatics Tool for HID1 Antibody (NBP1-84075)

Discover related pathways, diseases and genes to HID1 Antibody (NBP1-84075). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for HID1 Antibody (NBP1-84075)

View related products by pathway.

Blogs on HID1

There are no specific blogs for HID1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HID1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HID1