HGS Antibody

Images

 
Western Blot: HGS Antibody [NBP1-83203] - Analysis in human cell line HeLa.
Immunocytochemistry/ Immunofluorescence: HGS Antibody [NBP1-83203] - Staining of human cell line U-2 OS shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: HGS Antibody [NBP1-83203] - Staining of human skeletal muscle shows strong cytoplasmic positivity in subsets of muscle fibers.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HGS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PHVALYALEVMESVVKNCGQTVHDEVANKQTMEELKDLLKRQVEVNVRNKILYLIQAWAHAFRNEPKYKVVQDTYQIMKVEGHVFPEFKESDAMFAAERAPDWVDAEECHRCRVQFGVMTRKHHCRACGQIFCGKCS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HGS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HGS Protein (NBP1-83203PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HGS Antibody

  • FLJ39878
  • hepatocyte growth factor-regulated tyrosine kinase substrate
  • Hrs
  • HRSFLJ11421
  • human growth factor-regulated tyrosine kinase substrate
  • Protein pp110
  • Vps27
  • ZFYVE8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-38514
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46004
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83288
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-86170
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57521
Species: Hu
Applications: ICC/IF
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for HGS Antibody (NBP1-83203) (0)

There are no publications for HGS Antibody (NBP1-83203).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HGS Antibody (NBP1-83203) (0)

There are no reviews for HGS Antibody (NBP1-83203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HGS Antibody (NBP1-83203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HGS Products

Bioinformatics Tool for HGS Antibody (NBP1-83203)

Discover related pathways, diseases and genes to HGS Antibody (NBP1-83203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HGS Antibody (NBP1-83203)

Discover more about diseases related to HGS Antibody (NBP1-83203).
 

Pathways for HGS Antibody (NBP1-83203)

View related products by pathway.

PTMs for HGS Antibody (NBP1-83203)

Learn more about PTMs related to HGS Antibody (NBP1-83203).
 

Research Areas for HGS Antibody (NBP1-83203)

Find related products by research area.

Blogs on HGS

There are no specific blogs for HGS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HGS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HGS