HGFR/c-MET Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN |
| Predicted Species |
Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MET |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HGFR/c-MET Antibody - BSA Free
Background
Met is a receptor protein-tyrosine kinase (RPTK) for hepatocyte growth factor (HGF), which is a multifunctional cytokine controlling cell growth, morphogenesis, and motility. Met overexpression has been identified in a variety of human cancers (1). Met kinase domain possesses unique features that distinguish met from other members of the src family of protein tyrosine kinases. These results also demonstrate that the product of the activated met gene is a fusion protein and that the amino terminal end of this fusion protein exhibits homology to laminin B1 (2). Data suggest that RanBP9, functioning as an adaptor protein for the Met tyrosine kinase domain, can augment the HGF-Met signaling pathway and that RanBP9 overexpression may cause constitutive activation of the Ras signaling pathway (1). Hereditary papillary renal carcinoma (HPRC) is a recently recognized form of inherited kidney cancer Results suggest that missense mutations located in the MET proto-oncogene lead to constitutive activation of the Met protein and papillary renal carcinomas (3)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for HGFR/c-MET Antibody (NBP2-55719) (0)
There are no publications for HGFR/c-MET Antibody (NBP2-55719).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HGFR/c-MET Antibody (NBP2-55719) (0)
There are no reviews for HGFR/c-MET Antibody (NBP2-55719).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HGFR/c-MET Antibody (NBP2-55719) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HGFR/c-MET Products
Research Areas for HGFR/c-MET Antibody (NBP2-55719)
Find related products by research area.
|
Blogs on HGFR/c-MET