HGFR/c-MET Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HGF R/c-MET Antibody [NBP2-55719] - Staining of human cell line U-251 MG shows localization to plasma membrane.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HGFR/c-MET Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HGFR/c-MET Antibody - BSA Free (NBP2-55719) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SELVRYDARVHTPHLDRLVSARSVSPITEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALN
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MET
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HGFR/c-MET Recombinant Protein Antigen (NBP2-55719PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HGFR/c-MET Antibody - BSA Free

• AUTS9
• cMET
• c-MET
• EC 2.7.10
• EC 2.7.10.1
• hepatocyte growth factor receptor
• HGF R
• HGF receptor
• HGF/SF receptor
• HGFR
• Met (c-Met)
• met proto-oncogene (hepatocyte growth factor receptor)
• met proto-oncogene tyrosine kinase
• MET
• oncogene MET
• Proto-oncogene c-Met
• RCCP2
• Scatter factor receptor
• SF receptor
• Tyrosine-protein kinase Met

Background

Met is a receptor protein-tyrosine kinase (RPTK) for hepatocyte growth factor (HGF), which is a multifunctional cytokine controlling cell growth, morphogenesis, and motility. Met overexpression has been identified in a variety of human cancers (1). Met kinase domain possesses unique features that distinguish met from other members of the src family of protein tyrosine kinases. These results also demonstrate that the product of the activated met gene is a fusion protein and that the amino terminal end of this fusion protein exhibits homology to laminin B1 (2). Data suggest that RanBP9, functioning as an adaptor protein for the Met tyrosine kinase domain, can augment the HGF-Met signaling pathway and that RanBP9 overexpression may cause constitutive activation of the Ras signaling pathway (1). Hereditary papillary renal carcinoma (HPRC) is a recently recognized form of inherited kidney cancer Results suggest that missense mutations located in the MET proto-oncogene lead to constitutive activation of the Met protein and papillary renal carcinomas (3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MET