HFM1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HFM1 Antibody [NBP1-81954] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HFM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGNRECNHLCK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HFM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HFM1 Protein (NBP1-81954PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HFM1 Antibody

  • FLJ39011
  • helicase-like protein HFM1
  • HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae)
  • probable ATP-dependent DNA helicase HFM1
  • RP11-539G11.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4609
Species: Mu
Applications: Flow, CyTOF-ready, ICC
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31661
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76499
Species: Hu, Mu, Rt, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76498
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-148
Species: Hu, Mu, Rt, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, KD
38750002
Species: Ce
Applications: ELISA, ICC/IF, IHC
NB100-2595
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB200-191
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBP1-86829
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP1-58172
Species: Hu, Mu
Applications: WB
NBP1-87145
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Bv, Ha, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA
NBP2-53095
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HFM1 Antibody (NBP1-81954) (0)

There are no publications for HFM1 Antibody (NBP1-81954).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HFM1 Antibody (NBP1-81954) (0)

There are no reviews for HFM1 Antibody (NBP1-81954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HFM1 Antibody (NBP1-81954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HFM1 Products

Array NBP1-81954

Bioinformatics Tool for HFM1 Antibody (NBP1-81954)

Discover related pathways, diseases and genes to HFM1 Antibody (NBP1-81954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HFM1 Antibody (NBP1-81954)

Discover more about diseases related to HFM1 Antibody (NBP1-81954).
 

Pathways for HFM1 Antibody (NBP1-81954)

View related products by pathway.

Blogs on HFM1

There are no specific blogs for HFM1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HFM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HFM1