SLC39A3 Antibody


Western Blot: SLC39A3 Antibody [NBP1-86829] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunocytochemistry/ Immunofluorescence: SLC39A3 Antibody [NBP1-86829] - Staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: SLC39A3 Antibody [NBP1-86829] - Staining of human colon shows strong cytoplasmic positivity(granular pattern) in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SLC39A3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGL
Specificity of human SLC39A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC39A3 Protein (NBP1-86829PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC39A3 Antibody

  • solute carrier family 39 (zinc transporter), member 3
  • zinc transporter ZIP3
  • ZIP-3
  • ZIP3Solute carrier family 39 member 3
  • Zrt- and Irt-like protein 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Eq
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC, IF
Species: Hu
Applications: WB, ICC/IF
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC39A3 Antibody (NBP1-86829) (0)

There are no publications for SLC39A3 Antibody (NBP1-86829).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC39A3 Antibody (NBP1-86829) (0)

There are no reviews for SLC39A3 Antibody (NBP1-86829). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC39A3 Antibody (NBP1-86829) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC39A3 Antibody (NBP1-86829)

Discover related pathways, diseases and genes to SLC39A3 Antibody (NBP1-86829). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC39A3 Antibody (NBP1-86829)

Discover more about diseases related to SLC39A3 Antibody (NBP1-86829).

Pathways for SLC39A3 Antibody (NBP1-86829)

View related products by pathway.

PTMs for SLC39A3 Antibody (NBP1-86829)

Learn more about PTMs related to SLC39A3 Antibody (NBP1-86829).

Blogs on SLC39A3

There are no specific blogs for SLC39A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC39A3 Antibody and receive a gift card or discount.


Gene Symbol SLC39A3