HEY1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HEY1 Antibody [NBP3-35645] - Immunofluorescence analysis of A431 cells using HEY1 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: HEY1 Antibody [NBP3-35645] - Western blot analysis of various lysates using HEY1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HEY1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HEY1 Antibody - BSA Free (NBP3-35645) is a polyclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 114-129 of human HEY1 (NP_001269780.1).
  
  Sequence:
  IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HEY1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for HEY1 Antibody - BSA Free

• basic helix-loop-helix protein OAF1
• BHLHb31
• Cardiovascular helix-loop-helix factor 2
• CHF-2
• CHF2hHRT1
• Class B basic helix-loop-helix protein 31
• Hairy and enhancer of split-related protein 1
• hairy/enhancer-of-split related with YRPW motif 1
• hairy/enhancer-of-split related with YRPW motif protein 1
• Hairy-related transcription factor 1
• HERP2HES-related repressor protein 1
• HESR-1
• HESR1MGC1274
• HES-related repressor protein 2
• HRT1
• HRT-1OAF1

Background

Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. HEY genes are direct transcriptional targets of the Notch signaling pathways in Drosophila and vertebrates. Hey1 functions as a corepressor, providing a mechanism of cross-talk between Notch and androgen signaling pathways. It is excluded from the nucleus in most human prostate cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HEY1