Recombinant Human RBX1 Protein

Images

 
SDS-Page: RBX1 Recombinant Protein [H00009978-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human RBX1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-108 of Human RBX1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
RBX1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00009978-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human RBX1 Protein

  • BA554C12.1
  • EC 6.3.2.-
  • FLJ60363
  • MGC13357
  • Protein ZYP
  • Rbx1
  • Regulator of cullins 1
  • RING box protein 1
  • RING finger protein 75
  • ring-box 1
  • ring-box 1, E3 ubiquitin protein ligase
  • RING-box protein 1
  • RNF75MGC1481
  • ROC1E3 ubiquitin-protein ligase RBX1
  • ZYP protein

Background

RBX1( AAH01466, 1 a.a. - 109 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
H00143384-B01P
Species: Hu
Applications: WB, ELISA
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP1-87544
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
NBP1-59631
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58788
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-27152
Species: Mu
Applications: WB
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
H00009978-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for RBX1 Recombinant Protein (H00009978-P01)(3)

Reviews for RBX1 Recombinant Protein (H00009978-P01) (0)

There are no reviews for RBX1 Recombinant Protein (H00009978-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for RBX1 Recombinant Protein (H00009978-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBX1 Products

Bioinformatics Tool for RBX1 Recombinant Protein (H00009978-P01)

Discover related pathways, diseases and genes to RBX1 Recombinant Protein (H00009978-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBX1 Recombinant Protein (H00009978-P01)

Discover more about diseases related to RBX1 Recombinant Protein (H00009978-P01).
 

Pathways for RBX1 Recombinant Protein (H00009978-P01)

View related products by pathway.

PTMs for RBX1 Recombinant Protein (H00009978-P01)

Learn more about PTMs related to RBX1 Recombinant Protein (H00009978-P01).
 

Research Areas for RBX1 Recombinant Protein (H00009978-P01)

Find related products by research area.

Blogs on RBX1

There are no specific blogs for RBX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

RBX1 Antibody
NBP1-88742

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human RBX1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol RBX1