Hexokinase 1 Antibody

Images

 
Western Blot: Hexokinase Antibody [NBP1-85789] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Hexokinase Antibody [NBP1-85789] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: Hexokinase Antibody [NBP1-85789] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hexokinase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Hexokinase 1 Protein (NBP1-85789PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-85789 in the following applications:

Publications
Read Publication using NBP1-85789.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hexokinase 1 Antibody

  • Brain form hexokinase
  • EC 2.7.1
  • EC 2.7.1.1
  • glycolytic enzyme
  • Hexokinase 1
  • Hexokinase type I
  • hexokinase-1
  • HK I
  • HK1
  • HK1-ta
  • HK1-tb
  • HK1-tc
  • HKI
  • HXK1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-33137
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
MAB2337
Species: Hu
Applications: WB, IP
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP2-14986
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85789
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Hexokinase 1 Antibody (NBP1-85789)(1)

Review for Hexokinase 1 Antibody (NBP1-85789) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-85789:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Hexokinase 1 NBP1-85789
Enlarge
reviewed by:
Anonymous
WB Human 08/08/2014
View

Summary

ApplicationWestern Blot
Sample TestedNuclear and cytosolic lysates from 293T cells
SpeciesHuman

Blocking

Blocking Details5% milk in TBST buffer

Primary Anitbody

Dilution Ratio1:1000, diluted in TBST buffer+5% milk

Secondary Antibody

Secondary Descriptiongoat anti-rabbit IgG-HRP (SCBT)
Secondary Manufacturer Cat#sc-2004
Secondary Concentration1:20,000

Details

Detection NotesDetected using Santa Cruz Western Blotting Luminol Reagent, Exposure 1 min

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Hexokinase 1 Antibody (NBP1-85789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hexokinase 1 Products

Bioinformatics Tool for Hexokinase 1 Antibody (NBP1-85789)

Discover related pathways, diseases and genes to Hexokinase 1 Antibody (NBP1-85789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hexokinase 1 Antibody (NBP1-85789)

Discover more about diseases related to Hexokinase 1 Antibody (NBP1-85789).
 

Pathways for Hexokinase 1 Antibody (NBP1-85789)

View related products by pathway.

PTMs for Hexokinase 1 Antibody (NBP1-85789)

Learn more about PTMs related to Hexokinase 1 Antibody (NBP1-85789).
 

Research Areas for Hexokinase 1 Antibody (NBP1-85789)

Find related products by research area.

Blogs on Hexokinase 1

There are no specific blogs for Hexokinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
08/08/2014
Application: WB
Species: Human

Bioinformatics

Gene Symbol HK1
Entrez