Hexokinase 1 Antibody (6B7Q2) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hexokinase 1 (P19367). GLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPV |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
HK1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL
- Immunocytochemistry/ Immunofluorescence 1:200 - 1:800
- Immunohistochemistry 1:200 - 1:800
- Immunohistochemistry-Paraffin 1:200 - 1:800
- Immunoprecipitation 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells
- Knockout Validated
- Western Blot 1:1000 - 1:2000
|
| Theoretical MW |
102 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Hexokinase 1 Antibody (6B7Q2)
Background
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in five transcript variants which encode different isoforms, some of which are tissue-specific. Each isoform has a distinct N-terminus; the remainder of the protein is identical among all the isoforms. A sixth transcript variant has been described, but due to the presence of several stop codons, it is not thought to encode a protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: IA, ICC/IF, IHC, Simple Western, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ye
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: ICC/IF, IP, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IP, KO
Publications for Hexokinase 1 Antibody (NBP3-15274) (0)
There are no publications for Hexokinase 1 Antibody (NBP3-15274).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hexokinase 1 Antibody (NBP3-15274) (0)
There are no reviews for Hexokinase 1 Antibody (NBP3-15274).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Hexokinase 1 Antibody (NBP3-15274) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hexokinase 1 Products
Research Areas for Hexokinase 1 Antibody (NBP3-15274)
Find related products by research area.
|
Blogs on Hexokinase 1