HERPUD1 Antibody

Images

 
Western Blot: HERPUD1 Antibody [NBP1-83267] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: HERPUD1 Antibody [NBP1-83267] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HERPUD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSGKLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HERPUD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HERPUD1 Protein (NBP1-83267PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HERPUD1 Antibody

  • HERPMIF1
  • homocysteine-inducible endoplasmic reticulum stress-inducible ubiquitin-likedomain member 1 protein
  • homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-likedomain member 1
  • homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domainmember 1 protein
  • KIAA0025MMS-inducible
  • Methyl methanesulfonate (MMF)-inducible fragment protein 1
  • Mif1
  • SUP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF1543
Species: Hu
Applications: WB, IHC
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-2526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, KO
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-448
Species: Hu, Mu, Ca, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14113
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57809
Species: Hu
Applications: ICC/IF
NBP1-83267
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HERPUD1 Antibody (NBP1-83267) (0)

There are no publications for HERPUD1 Antibody (NBP1-83267).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERPUD1 Antibody (NBP1-83267) (0)

There are no reviews for HERPUD1 Antibody (NBP1-83267). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HERPUD1 Antibody (NBP1-83267) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HERPUD1 Products

Bioinformatics Tool for HERPUD1 Antibody (NBP1-83267)

Discover related pathways, diseases and genes to HERPUD1 Antibody (NBP1-83267). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERPUD1 Antibody (NBP1-83267)

Discover more about diseases related to HERPUD1 Antibody (NBP1-83267).
 

Pathways for HERPUD1 Antibody (NBP1-83267)

View related products by pathway.

PTMs for HERPUD1 Antibody (NBP1-83267)

Learn more about PTMs related to HERPUD1 Antibody (NBP1-83267).

Blogs on HERPUD1

There are no specific blogs for HERPUD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HERPUD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HERPUD1