HERC6 Antibody


Western Blot: HERC6 Antibody [NBP1-55025] - Titration: 0.2-1 ug/ml Positive Control: ACHN cell lysate.
Western Blot: HERC6 Antibody [NBP1-55025] - hek293 cell lysate at 1:1000.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

HERC6 Antibody Summary

Synthetic peptides corresponding to HERC6(hect domain and RLD 6) Antibody(against the N terminal of HERC6. Peptide sequence LSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAH.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HERC6 and was validated on Western blot.
Theoretical MW
115 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HERC6 Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • FLJ20637
  • HECT domain and RCC1-like domain-containing protein 6
  • hect domain and RLD 6
  • potential ubiquitin ligase
  • probable E3 ubiquitin-protein ligase HERC6


HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB

Publications for HERC6 Antibody (NBP1-55025) (0)

There are no publications for HERC6 Antibody (NBP1-55025).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HERC6 Antibody (NBP1-55025) (0)

There are no reviews for HERC6 Antibody (NBP1-55025). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HERC6 Antibody (NBP1-55025) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HERC6 Products

Bioinformatics Tool for HERC6 Antibody (NBP1-55025)

Discover related pathways, diseases and genes to HERC6 Antibody (NBP1-55025). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HERC6 Antibody (NBP1-55025)

Discover more about diseases related to HERC6 Antibody (NBP1-55025).

Pathways for HERC6 Antibody (NBP1-55025)

View related products by pathway.

PTMs for HERC6 Antibody (NBP1-55025)

Learn more about PTMs related to HERC6 Antibody (NBP1-55025).

Blogs on HERC6

There are no specific blogs for HERC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HERC6 Antibody and receive a gift card or discount.


Gene Symbol HERC6