SRGAP3 Antibody

Images

 
Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SRGAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKNPPGPVSSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRGAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SRGAP3 Protein (NBP1-88831PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGAP3 Antibody

  • SLIT-ROBO Rho GTPase activating protein 2
  • SLIT-ROBO Rho GTPase activating protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-24526
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-36945
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-81479
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24757
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93587
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90852
Species: Hu
Applications: IHC, IHC-P
NBP1-88831
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SRGAP3 Antibody (NBP1-88831) (0)

There are no publications for SRGAP3 Antibody (NBP1-88831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRGAP3 Antibody (NBP1-88831) (0)

There are no reviews for SRGAP3 Antibody (NBP1-88831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGAP3 Antibody (NBP1-88831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGAP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SRGAP3