Home » SRGAP3 » SRGAP3 Antibodies » SRGAP3 Antibody

SRGAP3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining in human cerebral cortex and pancreas tissues using anti-SRGAP3 antibody. Corresponding SRGAP3 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex, lymph node, testis and urinary bladder using Anti-SRGAP3 antibody NBP1-88831 (A) shows ...read more
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human testis.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human urinary bladder.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

SRGAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKNPPGPVSSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRS
Specificity
Specificity of human SRGAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRGAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SRGAP3 Protein (NBP1-88831PEP)
Publications
Read Publication using
NBP1-88831 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Rat reported in scientific literature (PMID:32237255).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGAP3 Antibody

  • SLIT-ROBO Rho GTPase activating protein 2
  • SLIT-ROBO Rho GTPase activating protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SRGAP1 Antibody
(5D2)
H00057522-M03
Western Blot: SRGAP1 Antibody (5D2) [H00057522-M03] - SRGAP1 expression in NIH/3T3 ( Cat # L018V1 ).
Immunohistochemistry-Paraffin: SRGAP1 Antibody (5D2) [H00057522-M03] - Analysis of monoclonal antibody to SRGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml
Western Blot: SRGAP1 Antibody (5D2) [H00057522-M03] - SRGAP1 expression in IMR-32 ( Cat # L008V1 ).
(2 Publications)
Species: Hu, Rt, Pm
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
ARHGAP1 Antibody
NBP1-85724
Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ARHGAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARHGAP1 Antibody [NBP1-85724] - Staining of human hippocampus shows positivity in neuropil.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(23 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
ARHGAP4 Antibody
NBP1-88527
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human colon.
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in human cell line RPMI-8226.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Rhodopsin Antibody
(1D4)
NBP1-47602
Western Blot: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis of Human Cell lysates showing detection of Rhodopsin protein using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (1D4) [NBP1-47602] - Analysis using Mouse Anti-Rhodopsin Monoclonal Antibody, Clone 1D4. Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Rhodopsin Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Dull epidermal staining.
(3 Publications)
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunohistochemistry-Paraffin: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Negative Control showing staining of paraffin embedded Mouse Adrenal Gland, with no primary antibody.
Immunohistochemistry-Paraffin: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Staining of paraffin embedded Mouse Adrenal Gland. Antibody at 4 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
Immunofluorescence: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IF
Cip4 Antibody (1A9)
H00009322-M01
Immunocytochemistry/Immunofluorescence: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of monoclonal antibody to TRIP10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunoprecipitation: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of TRIP10 transfected lysate using anti-TRIP10 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIP10 MaxPab rabbit polyclonal antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
RhoD Antibody
NBP1-58359
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Liver Tissue Observed Staining: Cytoplasm in sinusoids of liver Primary Antibody Concentration: 1 : 100 Other Working Concentrations: 1/600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X Expos
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
ARHGAP17 Antibody
NBP1-83870
Western Blot: ARHGAP17 Antibody [NBP1-83870] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: ARHGAP17 Antibody [NBP1-83870] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Rac1 Antibody
NB100-91266
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Mouse Brain (cerebral cortex), Image is courtesy of customer review.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunocytochemistry/Immunofluorescence: Rac1 Antibody [NB100-91266] - Rat spinal cord using Rabbit antibody to RAC1, RAC2 (100-150) at 1 : 1000 dilution. Pre-absorption of the antibody with the immunising peptide completely abolishes the immunostaining (not shown).
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
FNBP1 Antibody
NBP2-24526
Western Blot: FNBP1 Antibody [NBP2-24526] - analysis of FNBP1 in human liver lysate in the 1) absence and 2) presence of immunizing peptide using FNBP1 antibody at 0.1 ug/ml.
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-24526] - Formalin-fixed, paraffin-embedded human brain stained with FNBP1 antibody at 10 ug/ml. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Chimaerin 2
Antibody
NBP1-36945
Immunohistochemistry-Paraffin: Chimaerin 2 Antibody [NBP1-36945] - 3.8ug/ml staining of paraffin embedded Human Cortex. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
CHN 1 Antibody
(OTI2G6)
NBP2-46290
Western Blot: CHN 1 Antibody (2G6) [NBP2-46290] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CHN 1.
Immunocytochemistry/Immunofluorescence: CHN 1 Antibody (2G6) [NBP2-46290] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY CHN 1.
Immunohistochemistry-Paraffin: CHN 1 Antibody (2G6) [NBP2-46290] - Analysis of Human prostate tissue.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Phenylalanine
Hydroxylase Antibody
NBP1-52084
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - (0.1ug/ml) staining of Mouse (A) and Rat (B) Liver lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Staining of paraffin embedded Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: Phenylalanine Hydroxylase Antibody [NBP1-52084] - Analysis of Phenylalanine Hydroxylase Human Liver lysate (35ug protein in RIPA buffer) using this antibody at 0.3 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
FCHSD2 Antibody
NBP1-81479
Immunocytochemistry/Immunofluorescence: FCHSD2 Antibody [NBP1-81479] - Staining of human cell line A-431 shows localization to nuclear speckles, plasma membrane & actin filaments.
Immunohistochemistry-Paraffin: FCHSD2 Antibody [NBP1-81479] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: FCHSD2 Antibody [NBP1-81479] - Staining of human pancreas shows moderate membranous positivity in exocrine pancreas.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ARHGAP20 Antibody
NBP2-24757
Western Blot: ARHGAP20 Antibody [NBP2-24757] - Analysis of ARHGAP20 in rat brain lysate. Lane 1 shows pre-immune sera. Lane 2 shows NBP2-24757 tested at 8 ug/ml.
Immunohistochemistry-Paraffin: ARHGAP20 Antibody [NBP2-24757] - IHC staining of mouse brain using control (rabbit Ig) at 5 ug/ml.
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Recombinant Human
GRAF GST (N-Term) Pro ...
H00023092-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
(2 Publications)
Species: Hu
ARHGAP23 Antibody
NBP1-93587
Immunocytochemistry/Immunofluorescence: ARHGAP23 Antibody [NBP1-93587] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane.
Species: Hu
Applications: ICC/IF
ARHGAP21 Antibody
NBP1-90852
Immunohistochemistry: ARHGAP21 Antibody [NBP1-90852] - Staining of human gall bladder shows distinct nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
SRGAP3 Antibody
NBP1-88831
SRGAP3 Antibody
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for SRGAP3 Antibody (NBP1-88831)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for SRGAP3 Antibody (NBP1-88831) (0)

There are no reviews for SRGAP3 Antibody (NBP1-88831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGAP3 Antibody (NBP1-88831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SRGAP3 Products

Bioinformatics Tool for SRGAP3 Antibody (NBP1-88831)

Discover related pathways, diseases and genes to SRGAP3 Antibody (NBP1-88831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGAP3 Antibody (NBP1-88831)

Discover more about diseases related to SRGAP3 Antibody (NBP1-88831).
 

Pathways for SRGAP3 Antibody (NBP1-88831)

View related products by pathway.

Blogs on SRGAP3

There are no specific blogs for SRGAP3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGAP3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SRGAP3