New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » SRGAP3 » SRGAP3 Antibodies » SRGAP3 Antibody

SRGAP3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining in human cerebral cortex and pancreas tissues using anti-SRGAP3 antibody. Corresponding SRGAP3 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining in human cerebral cortex and pancreas tissues using anti-SRGAP3 antibody. Corresponding SRGAP3 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex, lymph node, testis and urinary bladder using Anti-SRGAP3 antibody NBP1-88831 (A) shows ...read more
Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human testis.
Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human urinary bladder.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

SRGAP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LKNPPGPVSSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRS
Predicted Species
Mouse (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SRGAP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SRGAP3 Protein (NBP1-88831PEP)
Publications
Read Publication using
NBP1-88831 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Rat reported in scientific literature (PMID:32237255).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SRGAP3 Antibody

  • SLIT-ROBO Rho GTPase activating protein 2
  • SLIT-ROBO Rho GTPase activating protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SRGAP1 Antibody
(5D2)
H00057522-M03
Western Blot: SRGAP1 Antibody (5D2) [H00057522-M03] - SRGAP1 expression in IMR-32 ( Cat # L008V1 ).
Western Blot: SRGAP1 Antibody (5D2) [H00057522-M03] - SRGAP1 expression in NIH/3T3 ( Cat # L018V1 ).
ELISA: SRGAP1 Antibody (5D2) [H00057522-M03] - Detection limit for recombinant GST tagged SRGAP1 is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, WB
ARHGAP1 Antibody
NBP1-85724
Immunocytochemistry/Immunofluorescence: ARHGAP1 Antibody [NBP1-85724] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
Western Blot: ARHGAP1 Antibody [NBP1-85724] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ARHGAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: ARHGAP1 Antibody [NBP1-85724] - Staining of human hippocampus shows positivity in neuropil.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(26 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ARHGAP4 Antibody
NBP1-88527
Western Blot: ARHGAP4 Antibody [NBP1-88527] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: ARHGAP4 Antibody [NBP1-88527] - Staining of human spleen shows high expression.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Rhodopsin Antibody
(B630)
NBP2-25160
Immunohistochemistry: Rhodopsin Antibody (B630) [NBP2-25160] - Rhodopsin expression and the prevalence of rod photoreceptors in the canine retina. (A) Fluorescence micrographs showing rhodopsin expression (red) in the ABCA4+/+ (left), ABCA4+/- (middle), and ABCA4-/- (right) rod outer segments. Scale bar = 10 um. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Western Blot: Rhodopsin Antibody (B630) [NBP2-25160] - Western blot analyses of ABCA4 (above), GAPDH (middle), and RHO (below) protein levels in retinal tissue of dogs with the three different genotypes. Image collected and cropped by CiteAb from the following publication. 50 ug of protein samples were resolved by SDS-PAGE, transferred to nitrocellulose membrane, and immunoblotted with the following primary antibodies: ABCA4 (NBP1-30032, 1:1000) and Rhodopsin (NBP2-25160, 1:5000), followed by Anti-Mouse IgG horseradish peroxidase-conjugated secondary antibody (R&D Systems, HAF007, 1:5000. Image collected and cropped by CiteAb from the following publication (doi.org/10.1371/journal.pgen.1007873) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: Rhodopsin Antibody (B630) [NBP2-25160] - High magnification confocal image of pig retinal section stained with NBP2-25160 (Green). Rhodopsin is most abundant in the rod outer segments (ROS) of retina, clearly localized in rod membranes. The rod inner segments (RIS) and rod nuclei in the outer nuclear layer (ONL) are also seen in this image. Nuclear DNA was stained with DAPI (blue).
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
DLC1 Antibody -
Isoform 1 and 3
NB300-917
Immunofluorescence: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunofluorescence: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Analysis of paraformaldehyde fixed U251 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/ml) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and vesicle staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Immunohistochemistry-Paraffin: DLC1 Antibody - Isoform 1 and 3 [NB300-917] - Staining of paraffin embedded Mouse Adrenal Gland. Antibody at 4 ug/mL. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
(2 Publications)
Species: Hu, Mu
Applications: IF, IHC, IHC-P
Cip4 Antibody (1A9)
H00009322-M01
Immunoprecipitation: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of TRIP10 transfected lysate using anti-TRIP10 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIP10 MaxPab rabbit polyclonal antibody.
Immunocytochemistry/Immunofluorescence: Cip4 Antibody (1A9) [H00009322-M01] - Analysis of monoclonal antibody to TRIP10 on HeLa cell . Antibody concentration 10 ug/ml.
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin: RhoD Antibody [NBP1-58359] - Human Tonsil Tissue, 4-8ug/ml.
Western Blot: RhoD Antibody [NBP1-58359] - Transfected 293T, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry: RhoD Antibody [NBP1-58359] - Human Bronchial Epithelial Tissue Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue Primary Antibody Concentration: 1 : 600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1 : 200 Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
ARHGAP17 Antibody
NBP1-83870
Western Blot: ARHGAP17 Antibody [NBP1-83870] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: ARHGAP17 Antibody [NBP1-83870] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: ARHGAP17 Antibody [NBP1-83870] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Rac1 Antibody
NB100-91266
Western Blot: Rac1 Antibody [NB100-91266] - WB on tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody dilution: 1:1000 incubated overnight at 4C.
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat spinal cord (ventral horn) using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
Immunohistochemistry: Rac1 Antibody [NB100-91266] - Rat ligated sciatic nerve using Rabbit antibody to RAC1, RAC2 whole serum at 1:1000 dilution. Pre-absorption of the antibody with the immunizing peptide completely abolishes the immunostaining (not shown).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
FNBP1 Antibody
NBP2-48542
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.
Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human lymph node shows high expression.
Western Blot: FNBP1 Antibody [NBP2-48542] - Staining of human skeletal muscle shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P, WB
Chimaerin 2
Antibody
NBP3-12294
Immunohistochemistry-Paraffin: Chimaerin 2 Antibody [NBP3-12294] - Rat cerebellum. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnification.
Western Blot: Chimaerin 2 Antibody [NBP3-12294] - 1:1000 antibody dilution in DiluObuffer. Apparent MW is 50 KDa.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
CHN 1 Antibody
(OTI2G6)
NBP2-46290
Western Blot: CHN 1 Antibody (OTI2G6) [NBP2-46290] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY CHN 1.
Immunocytochemistry/Immunofluorescence: CHN 1 Antibody (OTI2G6) [NBP2-46290] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY CHN 1.
Immunohistochemistry-Paraffin: CHN 1 Antibody (OTI2G6) [NBP2-46290] - Analysis of Carcinoma of Human kidney tissue.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Phenylalanine
Hydroxylase Antibody
NBP2-48615
Western Blot: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis using Anti-PAH antibody NBP2-48615 (A) shows similar pattern to independent antibody NBP1-80917 (B).
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Analysis in human liver and pancreas tissues. Corresponding Phenylalanine Hydroxylase RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Phenylalanine Hydroxylase Antibody [NBP2-48615] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Species: Hu
Applications: IHC, IHC-P, WB
FCHSD2 Antibody
NBP1-81479
Immunohistochemistry-Paraffin: FCHSD2 Antibody [NBP1-81479] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry-Paraffin: FCHSD2 Antibody [NBP1-81479] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: FCHSD2 Antibody [NBP1-81479] - Staining of human heart muscle shows moderate granular cytoplasmic positivity.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ARHGAP20 Antibody
NBP2-24757
Western Blot: ARHGAP20 Antibody [NBP2-24757] - Analysis of ARHGAP20 in rat brain lysate. Lane 1 shows pre-immune sera. Lane 2 shows NBP2-24757 tested at 8 ug/ml.
Immunohistochemistry-Paraffin: ARHGAP20 Antibody [NBP2-24757] - IHC staining of mouse brain using control (rabbit Ig) at 5 ug/ml.
Species: Hu, Pm
Applications: IHC, IHC-P, WB
GRAF Antibody
NBP2-38235
Immunocytochemistry/Immunofluorescence: GRAF Antibody [NBP2-38235] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP2-38235] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: GRAF Antibody [NBP2-38235] - Staining of human placenta shows moderate cytoplasmic and membranous positivity in trophoblastic cells.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ARHGAP23 Antibody
NBP1-93587
Immunocytochemistry/Immunofluorescence: ARHGAP23 Antibody [NBP1-93587] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & plasma membrane.
Species: Hu
Applications: ICC/IF
ARHGAP21 Antibody
NBP1-90852
Immunohistochemistry-Paraffin: ARHGAP21 Antibody [NBP1-90852] - Staining of human gall bladder shows distinct nuclear and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
SRGAP3 Antibody
NBP1-88831
SRGAP3 Antibody
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for SRGAP3 Antibody (NBP1-88831)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for SRGAP3 Antibody (NBP1-88831) (0)

There are no reviews for SRGAP3 Antibody (NBP1-88831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRGAP3 Antibody (NBP1-88831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SRGAP3 Products

Bioinformatics Tool for SRGAP3 Antibody (NBP1-88831)

Discover related pathways, diseases and genes to SRGAP3 Antibody (NBP1-88831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRGAP3 Antibody (NBP1-88831)

Discover more about diseases related to SRGAP3 Antibody (NBP1-88831).
 

Pathways for SRGAP3 Antibody (NBP1-88831)

View related products by pathway.

Blogs on SRGAP3

There are no specific blogs for SRGAP3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SRGAP3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SRGAP3