SRGAP3 Antibody

Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining in human cerebral cortex and pancreas tissues using anti-SRGAP3 antibody. Corresponding SRGAP3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex, lymph node, testis and urinary bladder using Anti-SRGAP3 antibody NBP1-88831 (A) shows similar protein distribution across tissues to independent antibody NBP2-38521 (B).

Western Blot: SRGAP3 Antibody [NBP1-88831] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex

Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human lymph node.

Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human testis.

Immunohistochemistry-Paraffin: SRGAP3 Antibody [NBP1-88831] - Staining of human urinary bladder.

• Reactivity: Hu, Rt, Mu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SRGAP3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LKNPPGPVSSEPASPLHTIVIRDPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRS
• Specificity: Specificity of human SRGAP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Predicted Species: Mouse (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SRGAP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SRGAP3 Protein (NBP1-88831PEP)

Reactivity Notes

Use in Rat reported in scientific literature (PMID:32237255).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SRGAP3 Antibody

• SLIT-ROBO Rho GTPase activating protein 2
• SLIT-ROBO Rho GTPase activating protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SRGAP3 Antibody (NBP1-88831)(1)

Publication using NBP1-88831

• Chen Z, Zhang S, Nie B et al. Distinct roles of srGAP3-Rac1 in the initiation and maintenance phases of neuropathic pain induced by paclitaxel J. Physiol. (Lond.) Apr 1 2020 [PMID: 32237255] (WB, Rat)

Bioinformatics

• Gene Symbol: SRGAP3