FBXL7 Antibody

Images

 
Western Blot: FBXL7 Antibody [NBP1-55053] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: FBXL7 Antibody [NBP1-55053] - Human kidney
Western Blot: FBXL7 Antibody [NBP1-55053] - Reccomended Titration: 1.25 ug/ml Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, Gp, RbSpecies Glossary
Applications WB, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FBXL7 Antibody Summary

Immunogen
Synthetic peptides corresponding to FBXL7(F-box and leucine-rich repeat protein 7) The peptide sequence was selected from the N terminal of FBXL7. Peptide sequence IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Equine (93%), Rabbit (92%), Guinea Pig (100%), Bovine (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FBXL7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
Application Notes
This is a rabbit polyclonal antibody against FBXL7 and was validated on Western Blot and immunohistochemistry-P. Use in Immunoprecipitation reported in scientific literature (PMID 25654763)
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-55053 in the following applications:

  • IP
    1 publication
  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in multiple pieces of scientific literature.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FBXL7 Antibody

  • FBL7FBL6F-box protein Fbl7
  • F-box and leucine-rich repeat protein 7F-box protein FBL6/FBL7
  • F-box/LRR-repeat protein 7
  • KIAA0840

Background

FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55046
Species: Hu
Applications: WB
H00003400-B01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-88831
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-404
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-88466
Species: Hu, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-75659
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-59130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76976
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83118
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FBXL7 Antibody (NBP1-55053)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(2)
All Species

Reviews for FBXL7 Antibody (NBP1-55053) (0)

There are no reviews for FBXL7 Antibody (NBP1-55053). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL7 Antibody (NBP1-55053) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FBXL7 Products

Bioinformatics Tool for FBXL7 Antibody (NBP1-55053)

Discover related pathways, diseases and genes to FBXL7 Antibody (NBP1-55053). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL7 Antibody (NBP1-55053)

Discover more about diseases related to FBXL7 Antibody (NBP1-55053).
 

Pathways for FBXL7 Antibody (NBP1-55053)

View related products by pathway.

PTMs for FBXL7 Antibody (NBP1-55053)

Learn more about PTMs related to FBXL7 Antibody (NBP1-55053).

Blogs on FBXL7

There are no specific blogs for FBXL7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXL7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL7
Uniprot