FBXL7 Antibody - BSA Free

Western Blot: FBXL7 Antibody [NBP1-55053] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: FBXL7 Antibody [NBP1-55053] - Human kidney

Western Blot: FBXL7 Antibody [NBP1-55053] - Reccomended Titration: 1.25 ug/ml Positive Control: HepG2 cell lysate

• Reactivity: Hu, Mu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

FBXL7 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to FBXL7(F-box and leucine-rich repeat protein 7) The peptide sequence was selected from the N terminal of FBXL7. Peptide sequence IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXL7
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunoprecipitation reported in scientific literature (PMID 25654763).
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in multiple pieces of scientific literature.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for FBXL7 Antibody - BSA Free

• FBL7FBL6F-box protein Fbl7
• F-box and leucine-rich repeat protein 7F-box protein FBL6/FBL7
• F-box/LRR-repeat protein 7
• KIAA0840

Background

FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXL7 Antibody (NBP1-55053)(2)

Publications using NBP1-55053

• Liu Y, Lear T, Iannone O et al. Pro-apoptotic F-box protein Fbxl7 regulates mitochondrial function by mediating the ubiquitylation and proteasomal degradation of survivin. J. Biol. Chem. 2015-03-16 [PMID: 25778398] (WB, Mouse)
• Liu Y, Lear T, Zhao Y et al. F-box protein Fbxl18 mediates polyubiquitylation and proteasomal degradation of the pro-apoptotic SCF subunit Fbxl7 Cell Death Dis. 2015-02-06 [PMID: 25654763] (WB, IP, Mouse)

Bioinformatics

• Gene Symbol: FBXL7
• Uniprot:
  • Q9UJT9(Human)