HERC5 Antibody

Images

 
Western Blot: HERC5 Antibody [H00051191-A01] - Detection against Immunogen (38.21 KDa) .

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HERC5 Antibody Summary

Immunogen
HERC5 (NP_057407, 915 a.a. - 1024 a.a.) partial recombinant protein with GST tag. YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG
Specificity
HERC5 - hect domain and RLD 5
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HERC5
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA.
Publications
Read Publications using
H00051191-A01 in the following applications:

  • WB
    2 publications

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50% Glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HERC5 Antibody

  • CEB1E3 ISG15--protein ligase HERC5
  • CEBP1
  • cyclin-E binding protein 1
  • Cyclin-E-binding protein 1
  • EC 6.3.2
  • EC 6.3.2.-
  • HECT domain and RCC1-like domain-containing protein 5
  • hect domain and RLD 5
  • HECT E3 ubiquitin ligase
  • probable E3 ubiquitin-protein ligase HERC5

Background

This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HERC5 Antibody (H00051191-A01)(7)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 7 of 7.
Publications using H00051191-A01 Applications Species
Jeon SJ, Chung KC. Covalent conjugation of ubiquitin-like ISG15 to apoptosis-inducing factor exacerbates toxic stimuli-induced apoptotic cell death Journal of Biological Chemistry 2022-10-01 [PMID: 36075291]
F El-Asmi, FP McManus, CE Brantis-de, JC Valle-Casu, P Thibault, MK Chelbi-Ali Cross-talk between SUMOylation and ISGylation in response to interferon Cytokine, 2020-02-07;129(0):155025. 2020-02-07 [PMID: 32044670]
Park SY, Yoon S, Kim H, Kim KK. 90K Glycoprotein Promotes Degradation of Mutant B-Catenin Lacking the ISGylation or Phosphorylation Sites in the N-terminus. Neoplasia 2016-09-23 [PMID: 27668402]
Im E, Yoo L, Hyun M et al. Covalent ISG15 conjugation positively regulates the ubiquitin E3 ligase activity of parkin. Open Biol 2016-08-01 [PMID: 27534820] (WB) WB
Woods MW, Tong JG, Tom SK et al. Interferon-induced HERC5 is evolving under positive selection and inhibits HIV-1 particle production by a novel mechanism targeting Rev/RRE-dependent RNA nuclear export. Retrovirology. 2014-04-03 [PMID: 24693865]
Woods MW, Kelly JN, Hattlmann CJ et al. Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag. Retrovirology. 2011-11-17 [PMID: 22093708]
Gao J, Wang HL, Shreve A et al. Fullerene derivatives induce premature senescence: a new toxicity paradigm or novel biomedical applications Toxicol Appl Pharmacol. 2010-04-15 [PMID: 20045429] (WB, Human) WB Human

Reviews for HERC5 Antibody (H00051191-A01) (0)

There are no reviews for HERC5 Antibody (H00051191-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HERC5 Antibody (H00051191-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HERC5 Products

Array H00051191-A01

Research Areas for HERC5 Antibody (H00051191-A01)

Find related products by research area.

Blogs on HERC5

There are no specific blogs for HERC5, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HERC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HERC5
Entrez
Uniprot