HERC5 Antibody

Western Blot: HERC5 Antibody [H00051191-A01] - Detection against Immunogen (38.21 KDa) .

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

HERC5 Antibody Summary

• Immunogen: HERC5 (NP_057407, 915 a.a. - 1024 a.a.) partial recombinant protein with GST tag. YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG
• Specificity: HERC5 - hect domain and RLD 5
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HERC5
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Western Blot 1:500
• Application Notes: The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50% Glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HERC5 Antibody

• CEB1E3 ISG15--protein ligase HERC5
• CEBP1
• cyclin-E binding protein 1
• Cyclin-E-binding protein 1
• EC 6.3.2
• EC 6.3.2.-
• HECT domain and RCC1-like domain-containing protein 5
• hect domain and RLD 5
• HECT E3 ubiquitin ligase
• probable E3 ubiquitin-protein ligase HERC5

Background

This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HERC5 Antibody (H00051191-A01)(5)

Publications using H00051191-A01

• Park SY, Yoon S, Kim H, Kim KK. 90K Glycoprotein Promotes Degradation of Mutant B-Catenin Lacking the ISGylation or Phosphorylation Sites in the N-terminus. Neoplasia 2016-09-23 [PMID: 27668402]
• Im E, Yoo L, Hyun M et al. Covalent ISG15 conjugation positively regulates the ubiquitin E3 ligase activity of parkin. Open Biol 2016-08-01 [PMID: 27534820] (WB)
• Woods MW, Tong JG, Tom SK et al. Interferon-induced HERC5 is evolving under positive selection and inhibits HIV-1 particle production by a novel mechanism targeting Rev/RRE-dependent RNA nuclear export. Retrovirology. 2014-04-03 [PMID: 24693865]
• Woods MW, Kelly JN, Hattlmann CJ et al. Human HERC5 restricts an early stage of HIV-1 assembly by a mechanism correlating with the ISGylation of Gag. Retrovirology. 2011-11-17 [PMID: 22093708]
• Gao J, Wang HL, Shreve A et al. Fullerene derivatives induce premature senescence: a new toxicity paradigm or novel biomedical applications Toxicol Appl Pharmacol. 2010-04-15 [PMID: 20045429] (WB, Human)

Bioinformatics

• Gene Symbol: HERC5
• Entrez:
  • 51191(Human)
• Uniprot:
  • NP_057407(Human)