RNF213 Antibody

Images

 
Western Blot: RNF213 Antibody [NBP1-88466] - TRAIP activity is required for Mcm7 ubiquitylation in mitosis. The same experiment from Fig 3B but with addition of the RNF213 blot. An asterisk "*" by the Psf2 blot ...read more
Immunocytochemistry/ Immunofluorescence: RNF213 Antibody [NBP1-88466] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Orthogonal Strategies: Western Blot: RNF213 Antibody [NBP1-88466] - Analysis in human cell lines A-549 and HEK293 using anti-RNF213 antibody. Corresponding RNF213 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity Hu, XpSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RNF213 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPYKYVIYNGESFEYEFIYKH
Specificity
Specificity of human RNF213 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF213
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF213 Protein (NBP1-88466PEP)
Publications
Read Publications using
NBP1-88466 in the following applications:

  • WB
    2 publications

Reactivity Notes

Xenopus reactivity reported in scientific literature (PMID: 30979826).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF213 Antibody

  • ALK lymphoma oligomerization partner on chromosome 17
  • C17orf27
  • chromosome 17 open reading frame 27
  • DKFZp762N1115
  • FLJ13051
  • KIAA1554MGC46622
  • KIAA1618
  • MGC9929
  • NET57
  • protein ALO17
  • ring finger protein 213

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57587
Species: Hu, Mu, Rt, Bv, Pm, Rb, Xp
Applications: WB, IHC, IHC-P, KD
NB300-576
Species: Hu, Mu, Rt, Ch, Gp, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75686
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF7250
Species: Hu
Applications: IHC
NBP2-61845
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi, S-ELISA
NBP2-45603
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55515
Species: Hu
Applications: ICC/IF
NB600-302
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Flow-IC
NBP1-55053
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-87486
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88831
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB110-61646
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88466
Species: Hu, Xp
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNF213 Antibody (NBP1-88466)(2)

We have publications tested in 1 confirmed species: Xenopus.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Xenopus
(1)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-88466 Applications Species
Gambus A, Priego Moreno S, Jones R, Poovathumkadavil D. Mitotic replisome disassembly in vertebrates. bioRxiv Sep 16 2018 (WB) WB
Priego Moreno, S;Jones, RM;Poovathumkadavil, D;Scaramuzza, S;Gambus, A; Mitotic replisome disassembly depends on TRAIP ubiquitin ligase activity Life Sci Alliance Apr 1 2019 [PMID: 30979826] (WB, Xenopus) WB Xenopus

Reviews for RNF213 Antibody (NBP1-88466) (0)

There are no reviews for RNF213 Antibody (NBP1-88466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF213 Antibody (NBP1-88466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional RNF213 Products

Bioinformatics Tool for RNF213 Antibody (NBP1-88466)

Discover related pathways, diseases and genes to RNF213 Antibody (NBP1-88466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF213 Antibody (NBP1-88466)

Discover more about diseases related to RNF213 Antibody (NBP1-88466).
 

Pathways for RNF213 Antibody (NBP1-88466)

View related products by pathway.

PTMs for RNF213 Antibody (NBP1-88466)

Learn more about PTMs related to RNF213 Antibody (NBP1-88466).
 

Research Areas for RNF213 Antibody (NBP1-88466)

Find related products by research area.

Blogs on RNF213

There are no specific blogs for RNF213, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF213 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF213