RNF213 Antibody - BSA Free

Western Blot: RNF213 Antibody [NBP1-88466] - TRAIP activity is required for Mcm7 ubiquitylation in mitosis. The same experiment from Fig 3B but with addition of the RNF213 blot. An asterisk

Immunocytochemistry/Immunofluorescence: RNF213 Antibody [NBP1-88466] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.

• Reactivity: Hu, Xp
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RNF213 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPYKYVIYNGESFEYEFIYKH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RNF213
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot Image collected and cropped by CiteAb from the following publication (http://www.life-science-alliance.org/lookup/doi/10.26508/lsa.201900390), licensed under a CC-BY license.
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  RNF213 Protein (NBP1-88466PEP)

Reactivity Notes

Xenopus reactivity reported in scientific literature (PMID: 30979826).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for RNF213 Antibody - BSA Free

• ALK lymphoma oligomerization partner on chromosome 17
• C17orf27
• chromosome 17 open reading frame 27
• DKFZp762N1115
• FLJ13051
• KIAA1554MGC46622
• KIAA1618
• MGC9929
• NET57
• protein ALO17
• ring finger protein 213

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RNF213 Antibody (NBP1-88466)(2)

Publications using NBP1-88466

• Gambus A, Priego Moreno S, Jones R, Poovathumkadavil D. Mitotic replisome disassembly in vertebrates. bioRxiv 2018-09-16 [PMID: 30979826] (WB)
• Priego Moreno, S;Jones, RM;Poovathumkadavil, D;Scaramuzza, S;Gambus, A; Mitotic replisome disassembly depends on TRAIP ubiquitin ligase activity Life Sci Alliance 2019-04-01 [PMID: 30979826] (WB, Xenopus)

Bioinformatics

• Gene Symbol: RNF213