RNF213 Antibody

Images

 
Orthogonal Strategies: Western Blot: RNF213 Antibody [NBP1-88466] - Analysis in human cell lines A-549 and HEK293 using anti-RNF213 antibody. Corresponding RNF213 RNA-seq data are presented for the same cell ...read more
Immunocytochemistry/ Immunofluorescence: RNF213 Antibody [NBP1-88466] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RNF213 Antibody [NBP1-88466] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

RNF213 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPYKYVIYNGESFEYEFIYKH
Specificity
Specificity of human RNF213 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF213
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RNF213 Protein (NBP1-88466PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RNF213 Antibody

  • ALK lymphoma oligomerization partner on chromosome 17
  • C17orf27
  • chromosome 17 open reading frame 27
  • DKFZp762N1115
  • FLJ13051
  • KIAA1554MGC46622
  • KIAA1618
  • MGC9929
  • NET57
  • protein ALO17
  • ring finger protein 213

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41206
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
MAB7357
Species: Hu
Applications: WB
AF4210
Species: Hu
Applications: WB, IHC
NBP1-82805
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00029107-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45603
Species: Hu
Applications: WB, Flow, IHC
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55515
Species: Hu
Applications: ICC/IF
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-55053
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for RNF213 Antibody (NBP1-88466) (0)

There are no publications for RNF213 Antibody (NBP1-88466).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RNF213 Antibody (NBP1-88466) (0)

There are no reviews for RNF213 Antibody (NBP1-88466). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RNF213 Antibody (NBP1-88466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RNF213 Products

Bioinformatics Tool for RNF213 Antibody (NBP1-88466)

Discover related pathways, diseases and genes to RNF213 Antibody (NBP1-88466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RNF213 Antibody (NBP1-88466)

Discover more about diseases related to RNF213 Antibody (NBP1-88466).
 

Pathways for RNF213 Antibody (NBP1-88466)

View related products by pathway.

PTMs for RNF213 Antibody (NBP1-88466)

Learn more about PTMs related to RNF213 Antibody (NBP1-88466).
 

Research Areas for RNF213 Antibody (NBP1-88466)

Find related products by research area.

Blogs on RNF213

There are no specific blogs for RNF213, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RNF213 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF213