HepaCAM Antibody

Images

 
Western Blot: HEPACAM Antibody [NBP1-60020] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HepaCAM Antibody Summary

Immunogen
Synthetic peptides corresponding to HEPACAM(hepatocyte cell adhesion molecule) The peptide sequence was selected from the N terminal of HEPACAM. Peptide sequence LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT.
Clonality
Polyclonal
Host
Rabbit
Gene
HEPACAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HEPACAM and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HepaCAM Antibody

  • cancer susceptibility
  • FLJ25530
  • glial cell adhesion molecule
  • GlialCAM
  • HepaCAM
  • hepatic and glial cell adhesion molecule
  • hepatocyte cell adhesion molecule
  • Protein hepaCAM

Background

HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30249
Species: Hu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-81555
Species: Hu
Applications: IHC, IHC-P
H00029895-M05
Species: Hu
Applications: WB, ELISA
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30954
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5918
Species: Hu, Mu
Applications: WB, Simple Western
NBP1-46568
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for HepaCAM Antibody (NBP1-60020) (0)

There are no publications for HepaCAM Antibody (NBP1-60020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HepaCAM Antibody (NBP1-60020) (0)

There are no reviews for HepaCAM Antibody (NBP1-60020). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HepaCAM Antibody (NBP1-60020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HepaCAM Antibody Products

HepaCAM NBP1-60020

Related Products by Gene

Bioinformatics Tool for HepaCAM Antibody (NBP1-60020)

Discover related pathways, diseases and genes to HepaCAM Antibody (NBP1-60020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HepaCAM Antibody (NBP1-60020)

Discover more about diseases related to HepaCAM Antibody (NBP1-60020).
 

Pathways for HepaCAM Antibody (NBP1-60020)

View related products by pathway.

PTMs for HepaCAM Antibody (NBP1-60020)

Learn more about PTMs related to HepaCAM Antibody (NBP1-60020).

Blogs on HepaCAM

There are no specific blogs for HepaCAM, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HepaCAM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HEPACAM
Entrez
Uniprot

Customers Who Bought This Also Bought

HepaCAM RNAi
H00220296-R02-20nmol