Recombinant Human Hemoglobin A1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Hemoglobin A1 Protein [H00003039-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Hemoglobin A1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 33-142 of Human Hemoglobin A1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
HBA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00003039-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hemoglobin A1 GST (N-Term) Protein

  • alpha one globin
  • alpha-1 globin
  • alpha-1-globin
  • alpha-globin
  • CD31
  • hemoglobin alpha 1 globin chain
  • Hemoglobin alpha chain
  • hemoglobin alpha-1 chain
  • hemoglobin subunit alpha
  • hemoglobin, alpha 1
  • MGC126895
  • MGC126897

Background

HBA1 - hemoglobin, alpha 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF3628
Species: Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
210-TA
Species: Hu
Applications: BA
796-IC
Species: Mu
Applications: BA
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
DNDG00
Species: Hu
Applications: ELISA
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BBA16
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, WB
233-FB/CF
Species: Hu
Applications: BA
AF644
Species: Mu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF1002
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-33050
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00003039-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01)(2)


Showing Publications 1 - 2 of 2.
Publications using H00003039-Q01 Applications Species
Baudin-creuza V, Vasseur C, Galacteros F. Method for diagnosing a hemoglobin-related disorder. United States Patent Application. 2014 Oct [PMID: 24918529]
Baudin-creuza V, Vasseur C, Galacteros F. et al. Method for diagnosing a hemoglobin-related disorder. United States Patent Application Oct 15 2015

Reviews for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01) (0)

There are no reviews for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hemoglobin A1 Products

Bioinformatics Tool for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01)

Discover related pathways, diseases and genes to Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01)

Discover more about diseases related to Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01).
 

Pathways for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01)

View related products by pathway.

PTMs for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01)

Learn more about PTMs related to Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01).
 

Research Areas for Hemoglobin A1 Partial Recombinant Protein (H00003039-Q01)

Find related products by research area.

Blogs on Hemoglobin A1

There are no specific blogs for Hemoglobin A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hemoglobin A1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HBA1