Hematopoietic Prostaglandin D Synthase/HPGDS Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Hematopoietic Prostaglandin D Synthase/HPGDS Antibody - BSA Free (NBP1-83322) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HPGDS |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50-1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody - BSA Free
Background
Prostaglandin D synthase catalyzes the isomerization of PGH2 to produce PGD2. Prostaglandin D synthase induces sleep, regulates nociception, inhibits platelet aggregation, and acts as an allergic mediator. Two distinct types of PGD synthase have been identified, namely the lipocalin type enzyme (b-trace) and the hematopoietic enzyme. Lipocalin type prostaglandin D synthase is localized in the central nervous system and male genital organs of various mammals and the human heart. This enzyme has been identified as b-trace, which is a major protein in human cerebrospinal fluid. Hematopoietic prostaglandin D synthase is widely distributed in the peripheral tissues and is localized in the antigen-presenting cells, mast cells, and megakaryocytes. This enzyme, which requires glutathione for activity, belongs to the sigma-class of glutathione-S-transferases.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Gp, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P
Publications for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322) (0)
There are no publications for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322) (0)
There are no reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Hematopoietic Prostaglandin D Synthase/HPGDS Products
Research Areas for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322)
Find related products by research area.
|
Blogs on Hematopoietic Prostaglandin D Synthase/HPGDS