Hematopoietic Prostaglandin D Synthase/HPGDS Antibody

Images

 
Immunohistochemistry-Paraffin: Hematopoietic Prostaglandin D Synthase/HPGDS Antibody [NBP1-83322] - Staining of human lung shows strong cytoplasmic positivity in mast cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hematopoietic Prostaglandin D Synthase/HPGDS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPGDS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hematopoietic Prostaglandin D Synthase/HPGDS Protein (NBP1-83322PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody

  • EC 2.5.1.18
  • EC 5.3.99.2
  • glutathione S-transferase sigma
  • Glutathione S-transferase
  • Glutathione-dependent PGD synthase
  • Glutathione-requiring prostaglandin D synthase
  • GST class-sigma
  • GSTS
  • GSTShematopoietic prostaglandin D2 synthase
  • hematopoietic prostaglandin D synthase
  • HPGDS
  • H-PGDS
  • PGDS
  • PGDSglutathione-dependent PGD synthetase
  • Prostaglandin-H2 D-isomerase
  • PTGDS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-00178
Species: Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87311
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP2-19014
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-83322
Species: Hu
Applications: IHC, IHC-P

Publications for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322) (0)

There are no publications for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322) (0)

There are no reviews for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hematopoietic Prostaglandin D Synthase/HPGDS Products

Bioinformatics Tool for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322)

Discover related pathways, diseases and genes to Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322)

Discover more about diseases related to Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322).
 

Pathways for Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (NBP1-83322)

View related products by pathway.

Blogs on Hematopoietic Prostaglandin D Synthase/HPGDS

There are no specific blogs for Hematopoietic Prostaglandin D Synthase/HPGDS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hematopoietic Prostaglandin D Synthase/HPGDS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPGDS
Entrez