HEM1 Antibody

Images

 
Western Blot: HEM1 Antibody [NBP1-79231] - 293T cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HEM1 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human NCKAP1L. Peptide sequence LPLLATDPSSFYSIEKDGYNNNIHCLTKAIIQVSAALFTLYNKNIETHLK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCKAP1L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against NCKAP1L and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HEM1 Antibody

  • Hematopoietic protein 1HEM1Membrane-associated protein HEM-1
  • NCK-associated protein 1-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5514
Species: Hu, Mu
Applications: WB
NB100-2307
Species: Hu
Applications: WB
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-66139
Species: Hu
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-37912
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-33600
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-29942
Species: Hu, Rt
Applications: WB, Flow, IHC-P
H00003757-Q01
Species: Hu
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86872
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HEM1 Antibody (NBP1-79231) (0)

There are no publications for HEM1 Antibody (NBP1-79231).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEM1 Antibody (NBP1-79231) (0)

There are no reviews for HEM1 Antibody (NBP1-79231). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HEM1 Antibody (NBP1-79231) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Array NBP1-79231

Bioinformatics Tool for HEM1 Antibody (NBP1-79231)

Discover related pathways, diseases and genes to HEM1 Antibody (NBP1-79231). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HEM1 Antibody (NBP1-79231)

Discover more about diseases related to HEM1 Antibody (NBP1-79231).
 

Pathways for HEM1 Antibody (NBP1-79231)

View related products by pathway.

Blogs on HEM1

There are no specific blogs for HEM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCKAP1L
Uniprot