HECA Antibody

Images

 
Immunohistochemistry: HECA Antibody [NBP1-85189] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HECA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RSSRYLGEFLKNAIHLEPHKKAMAGGHVFRNAHFDYSPAGLAVHRGGHFDTPVQFLRRLDLSELLTHIPRHKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVFEQFPLVDGTLFLSPSRHDEIEYDVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HECA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HECA Protein (NBP1-85189PEP)
Publications
Read Publication using
NBP1-85189 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HECA Antibody

  • dJ225E12.1
  • HDCHHDC
  • HDCL
  • headcase homolog (Drosophila)
  • headcase protein homolog
  • hHDC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-26612
Species: Hu
Applications: IP (-), WB
366-6C/CF
Species: Hu
AF7637
Species: Hu
Applications: WB
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NB100-2803
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB4726
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-31993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-85189
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for HECA Antibody (NBP1-85189)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HECA Antibody (NBP1-85189) (0)

There are no reviews for HECA Antibody (NBP1-85189). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HECA Antibody (NBP1-85189) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HECA Products

Bioinformatics Tool for HECA Antibody (NBP1-85189)

Discover related pathways, diseases and genes to HECA Antibody (NBP1-85189). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HECA Antibody (NBP1-85189)

Discover more about diseases related to HECA Antibody (NBP1-85189).
 

Pathways for HECA Antibody (NBP1-85189)

View related products by pathway.

Research Areas for HECA Antibody (NBP1-85189)

Find related products by research area.

Blogs on HECA

There are no specific blogs for HECA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HECA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HECA