EFS Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: IYKIPRASGTQLAAPRDALEVYDVPPTALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALAS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EFS |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for EFS Antibody
Background
EFS (Embryonal Fyn-associated substrate) is a 561 amino acid docking protein. It contains an SH3 domain, which is known to be important in intracellular signal transduction. It helps play a role in coordinating tyrosine-kinase-based signal transduction related to cell adhesion. It may play a role in metastatic colorectal cancer, ovarian carcinoma, alzheimer's disease, prostate cancer, myotonic dystrophy, lung cancer, breast cancer, crohn's disease, gastric adenocarcinoma and multiple myeloma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, IHC
Publications for EFS Antibody (NBP2-31993) (0)
There are no publications for EFS Antibody (NBP2-31993).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EFS Antibody (NBP2-31993) (0)
There are no reviews for EFS Antibody (NBP2-31993).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EFS Antibody (NBP2-31993) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EFS Products
Bioinformatics Tool for EFS Antibody (NBP2-31993)
Discover related pathways, diseases and genes to EFS Antibody (NBP2-31993). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for EFS Antibody (NBP2-31993)
Discover more about diseases related to EFS Antibody (NBP2-31993).
| | Pathways for EFS Antibody (NBP2-31993)
View related products by pathway.
|
PTMs for EFS Antibody (NBP2-31993)
Learn more about PTMs related to EFS Antibody (NBP2-31993).
| | Research Areas for EFS Antibody (NBP2-31993)
Find related products by research area.
|
Blogs on EFS