![Western Blot: EFS Antibody [NBP2-31993] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize2/EFS-Antibody-Western-Blot-NBP2-31993-img0003.jpg "Western Blot: EFS Antibody [NBP2-31993] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IYKIPRASGTQLAAPRDALEVYDVPPTALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EFS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
-Immunohistochemistry-NBP2-46349-img0001.jpg)
-Immunohistochemistry-NBP2-46349-img0002.jpg)
-Immunohistochemistry-NBP2-46349-img0003.jpg)
-Flow-Cytometry-NBP2-00532-img0001.jpg)
-Flow-Cytometry-NBP2-00532-img0002.jpg)
-Flow-Cytometry-NBP2-00532-img0003.jpg)
-Flow-Cytometry-NB600-1071-img0015.jpg)
-Flow-Cytometry-NB600-1071-img0002.jpg)
-Immunocytochemistry-Immunofluorescence-NB600-1071-img0003.jpg)
---Azide-and-BSA-Free-Western-Blot-NBP2-80739-img0001.jpg)
-Azide-and-BSA-Free-Flow-Cytometry-NBP2-80739-img0003.jpg)
---Azide-and-BSA-Free-Immunocytochemistry-NBP2-80739-img0002.jpg)
-Western-Blot-NB600-1335-img0011.jpg)
-Flow-Cytometry-NB600-1335-img0012.jpg)
-Immunohistochemistry-Paraffin-NB600-1335-img0008.jpg)
-Western-Blot-NB200-109-img0001.jpg)
-Western-Blot-NB200-109-img0002.jpg)
-Immunocytochemistry--Immunofluorescence-NB200-109-img0003.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for EFS Antibody (NBP2-31993)Discover more about diseases related to EFS Antibody (NBP2-31993).
| Pathways for EFS Antibody (NBP2-31993)View related products by pathway.
|
PTMs for EFS Antibody (NBP2-31993)Learn more about PTMs related to EFS Antibody (NBP2-31993).
| Research Areas for EFS Antibody (NBP2-31993)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: EFS Antibody [NBP2-31993] - Staining of human liver shows strong cytoplasmic and membranous positivity in bile duct cells.](http://images.novusbio.com/fullsize2/EFS-Antibody-Immunohistochemistry-NBP2-31993-img0001.jpg "Immunohistochemistry-Paraffin: EFS Antibody [NBP2-31993] - Staining of human liver shows strong cytoplasmic and membranous positivity in bile duct cells.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
---(82-398-aa)-Immunocytochemistry-Immunofluorescence-NB100-1699-img0009.jpg)
---(82-398-aa)-Western-Blot-NB100-1699-img0010.jpg)
---(82-398-aa)-Western-Blot-NB100-1699-img0011.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")