HBG1/2 Antibody - BSA Free

Western Blot: Hemoglobin gamma-2 chain Antibody [NBP3-09322] - Western blot analysis of Hemoglobin gamma-2 chain in Rat Stomach as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HBG1/2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HBG1/2 Antibody - BSA Free (NBP3-09322) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hbe1 (NP_001008890). Peptide sequence MVNFTAEEKSLINGLWSKVNVEEVGGEALGRLLVVYPWTQRFFDSFGNLS
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HBG1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HBG1/2 Antibody - BSA Free

• abnormal hemoglobin
• A-gamma globin
• gamma A hemoglobin
• gamma globin
• Gamma-1-globin
• gamma-2-globin
• gamma-globin chain
• G-gamma globin Paulinia
• Hb F Agamma
• hb F Ggamma
• HBGA
• HBGR
• HBG-T1
• HBG-T2
• Hemoglobin gamma-1 chain
• hemoglobin gamma-2 chain
• Hemoglobin gamma-A chain
• hemoglobin gamma-G chain
• hemoglobin subunit gamma-1
• hemoglobin subunit gamma-2
• hemoglobin, gamma A
• hemoglobin, gamma G
• hemoglobin, gamma, regulator of
• HSGGL1
• methemoglobin
• PRO2979
• TNCY

Background

The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HBG1