HB-EGF Antibody (1A4)

Images

 
There are currently no images for HB-EGF Antibody (H00001839-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1A4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HB-EGF Antibody (1A4) Summary

Immunogen
HBEGF (AAH33097.1, 20 a.a. - 208 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Specificity
HBEGF - heparin-binding EGF-like growth factor
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HBEGF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HB-EGF Antibody (1A4)

  • diphtheria toxin receptor (heparin-binding epidermal growth factor-like growthfactor)
  • Dtr
  • DTRHEGFLdiphtheria toxin receptor (heparin-binding EGF-like growth factor)
  • Dts
  • DTSF
  • HBEGF
  • HB-EGF
  • Hegfl
  • heparin-binding EGF-like growth factor
  • heparin-binding epidermal growth factor
  • proheparin-binding EGF-like growth factor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
259-HE
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00001839-M02
Species: Hu
Applications: ELISA

Publications for HB-EGF Antibody (H00001839-M02) (0)

There are no publications for HB-EGF Antibody (H00001839-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HB-EGF Antibody (H00001839-M02) (0)

There are no reviews for HB-EGF Antibody (H00001839-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HB-EGF Antibody (H00001839-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HB-EGF Products

Bioinformatics Tool for HB-EGF Antibody (H00001839-M02)

Discover related pathways, diseases and genes to HB-EGF Antibody (H00001839-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HB-EGF Antibody (H00001839-M02)

Discover more about diseases related to HB-EGF Antibody (H00001839-M02).
 

Pathways for HB-EGF Antibody (H00001839-M02)

View related products by pathway.

PTMs for HB-EGF Antibody (H00001839-M02)

Learn more about PTMs related to HB-EGF Antibody (H00001839-M02).

Blogs on HB-EGF

There are no specific blogs for HB-EGF, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HB-EGF Antibody (1A4) and receive a gift card or discount.

Bioinformatics

Gene Symbol HBEGF
Entrez
OMIM
Uniprot