HAPLN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-84376] - Staining of human liver.

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-84376] - Staining of human placenta shows high expression.

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-84376] - Staining of human prostate shows low expression as expected.

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-84376] - Staining in human placenta and prostate tissues using anti-HAPLN1 antibody. Corresponding HAPLN1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-84376] - Staining of human colon.

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-84376] - Staining of human cerebral cortex.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HAPLN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HAPLN1 Antibody - BSA Free (NBP1-84376) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVA
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HAPLN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HAPLN1 Protein (NBP1-84376PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HAPLN1 Antibody - BSA Free

• Cartilage link protein
• Cartilage-link protein
• Cartilage-linking protein 1
• CRTL1
• CRTL1cartilage linking protein 1
• HAPLN1
• hyaluronan and proteoglycan link protein 1
• Proteoglycan link protein

Background

Th extracellular matrix of cartilage consists of a number of interacting macromolecules that are unique to that tissue. The most studied group of these molecules are those that make up the ternary complex involving proteoglycan monomer, link protein (LP) , and hyaluronic acid (HA). As many as 100 proteoglycan monomers and LPs can be found to interact with a single HA polymer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HAPLN1